(data stored in ACNUC30630 zone)

EMBL: CP000113.PE365

CP000113.PE365       Location/Qualifiers
FT   CDS_pept        complement(441692..442606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0377"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92673"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DFC2"
FT                   /protein_id="ABF92673.1"
FT                   /translation="MLHLTPRRTLDLEAPAAPGRPSHVTASIGLVRSGDWLYTVADEPL
FT                   HLAAFPLSRASPGHGVVLFANHQPEAPVSLKSSQPDLEVPCLLAPQGSSPHGSLLMLPS
FT                   GISAGRQRGALVALGADGTLAGDARAVDVTALYTQISREFGPLRIAGAAMSGGLMRLLQ
FT                   RGSGEPGTDALVDLDAERVLRGLEAGALGPDVVRMTRRWELGQAGGMRLSFTAASPLPG
FT                   GRMVFTATAGSTGPTATVSGSVVGVLAPDGSPQFLDALEGHVTVTGVDARVEQGRVRLL
FT                   LAALSEDGAGPANLLEATLDVPA"
     atgcttcacc tgaccccacg gcgcaccctc gacctggagg cgcccgccgc gccaggacgt        60
     ccgtctcacg tcaccgcctc gatcggactg gtccgctcgg gcgactggct ctacaccgtc       120
     gcggatgagc cgctgcacct ggccgcgttc cccctgtcga gggcaagtcc cggtcatggc       180
     gtggtgctct tcgcgaacca ccagcccgaa gcgcccgtct ccctcaagtc gtcgcagccc       240
     gacctggagg tgccctgcct gctggcgccc cagggcagct cgccccacgg ttcgctgctg       300
     atgctgccgt cgggcatctc cgcgggcagg cagcgcggcg cgctggtcgc cctgggcgcg       360
     gacggcaccc tggcgggaga tgcccgggcc gtggacgtca cggcgctgta cacccagatc       420
     agccgggagt tcggaccgct ccgcatcgcc ggggcggcga tgtcgggcgg actgatgcgg       480
     ttgctccagc gcggcagcgg cgagcccggc accgacgccc tcgtggacct ggacgcggag       540
     cgggtactgc gcggactgga agccggcgcg ctgggcccgg acgtagtgcg catgacgcgc       600
     cgatgggagc tgggacaggc cggaggcatg cggctgtcct tcacggcggc gtcgccgctt       660
     cctggcgggc ggatggtctt caccgcgacc gcggggagca ccggcccgac ggcaaccgtg       720
     agcggctccg tcgtgggcgt gctggcgccg gatggctcgc cgcagttcct cgacgcgctg       780
     gagggccacg tgacagtgac aggcgtggat gcccgggtgg aacaggggcg cgtgcggctg       840
     ctcctggcgg ccctctccga agatggggcg ggccccgcga acctgctgga agcgacgctg       900
     gacgtcccgg cgtag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page