(data stored in ACNUC30630 zone)

EMBL: CP000113.PE37

CP000113.PE37        Location/Qualifiers
FT   CDS_pept        46167..47252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0040"
FT                   /product="putative glucose 1-dehydrogenase"
FT                   /note="identified by similarity to GB:CAC42505.1; match to
FT                   protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89793"
FT                   /db_xref="GOA:Q1DGA0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGA0"
FT                   /protein_id="ABF89793.1"
FT                   /translation="MKAVAVFPQKREVRVITDAPEPRIQSPTQVKVRTREIGVCGTDKE
FT                   IIEFVYGSPPPGSDHLILGHECLGEVVEVGEAVRGLSRGDWVVPRVRRPCPHATCPPCR
FT                   GGHPDFCITGDYTERGIKGAHGFGAESFVEDVAYLHRVPAELREVAVLTEPLTIAEKAL
FT                   RQLERFQDRLPWRAGPGRAVVLGAGPVGLLGAMALARRGYATTVYSRSPKPNVKAEASE
FT                   AMGVPYISSKEVRPEELVRRVGAADVIYEAAGVAKAALETLKALGPNGVCILTGVPSKE
FT                   EPFDVSPVLKDVVLGNQVLVGTVNAADVDFDMALEDLRHFQARWPGGLERLICARHSPE
FT                   DFCDVVTGKKSGGIKDVIRFI"
     atgaaggccg tggccgtctt cccccagaag cgcgaggtgc gtgtcatcac cgacgccccc        60
     gagccccgca tccagtcccc cacgcaggtg aaggtgcgga cgcgggaaat cggggtgtgt       120
     ggcacggaca aggaaatcat cgagttcgtc tacggctccc cgccgccggg ctcggaccac       180
     ctcatcctgg gccacgagtg tctgggcgag gtggtggagg tgggcgaggc cgtccggggc       240
     ctgagccgcg gggactgggt ggtgccccgc gtgcgccggc cgtgcccgca tgccacctgt       300
     ccgccgtgcc gcgggggcca tccggacttc tgcatcaccg gcgattacac cgagcgggga       360
     atcaagggcg cccacggctt cggcgccgag tccttcgtgg aggacgtggc ctacctgcac       420
     cgggtgcccg cggagctgcg cgaggtggcg gtgctcaccg agccgctcac catcgcggag       480
     aaggccctcc gccaactgga gcgcttccag gaccggctgc cctggagggc gggcccgggc       540
     cgcgcggtgg tgctgggtgc ggggccggtg gggttgctgg gcgccatggc gctggcccgc       600
     cggggttatg ccaccacggt gtattcgcgc agccccaagc ccaacgtgaa ggccgaggca       660
     tcggaggcga tgggggtgcc ctacatctcc tcgaaggagg tgcggccaga ggagctggtc       720
     cgcagggtcg gcgccgcgga cgtcatctac gaggccgcgg gcgtggcgaa ggcggcgctg       780
     gagacgctga aggcgctggg ccccaacggc gtctgcatcc tcacgggtgt gccgtcgaag       840
     gaggagccct tcgacgtgtc accggtgctc aaggacgtgg tgctgggcaa ccaggtgctg       900
     gtgggcacgg tgaacgcggc ggatgtcgac ttcgacatgg cgctggagga cttgcggcac       960
     ttccaggccc gctggcccgg ggggctggag cggctcatct gcgccaggca ctcgcccgag      1020
     gacttctgcg acgtcgtcac tggcaagaag tccggcggca tcaaggacgt catccgcttc      1080
     atctga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page