(data stored in ACNUC30630 zone)

EMBL: CP000113.PE4

CP000113.PE4         Location/Qualifiers
FT   CDS_pept        complement(4009..4620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91172"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD3"
FT                   /protein_id="ABF91172.1"
FT                   /translation="MPPVLGSLPALASRRAGGGRCLGNVGCPRSGKRPKPDTGEATVMA
FT                   NIREEQGEAAEGRSATPSLKEQRSESHAAQTYMAFLKDLEANAGVVRGLAEKAAQSVLC
FT                   LLEQRLMDTEAKHLEAQLPRKVRDMLKRCPRHEGKVARKYKLEQFLAMVAEELDTTPNE
FT                   AERLARAVFVTVRNHISEGEADDVMGQLPADLRSLWVPEA"
     gtgccgccgg tgcttggctc gcttcccgcc ctggcgtccc ggcgcgcggg gggcggccgg        60
     tgcctgggga acgtggggtg cccacgctca gggaagagac ccaagcccga caccggggag       120
     gccaccgtca tggcgaacat acgtgaggag cagggagagg cagcggaggg ccggagcgct       180
     acgcccagcc tcaaggagca gcgcagtgag tcgcacgcgg cgcagaccta tatggccttc       240
     ttgaaggacc tcgaagcgaa cgcgggcgtc gttcgtggcc tggcggagaa ggccgcgcag       300
     tccgtgctgt gtctgctgga gcaacgcctc atggacaccg aggcgaagca cctggaggcc       360
     cagcttccgc ggaaggtgag ggacatgctg aagcggtgtc ctcggcacga gggcaaggtc       420
     gcccggaagt acaagctgga gcagttcctc gccatggtgg ccgaggagct cgacaccacg       480
     cccaacgagg ccgaacgcct ggcccgggcc gtgttcgtca cggtgcgaaa tcacatcagc       540
     gagggcgagg ccgacgacgt catgggccag ctccccgcag acctgcgctc gttgtgggtg       600
     cccgaggcct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page