(data stored in ACNUC30630 zone)

EMBL: CP000113.PE40

CP000113.PE40        Location/Qualifiers
FT   CDS_pept        complement(51872..53212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02270"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86677"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG97"
FT                   /protein_id="ABF86677.1"
FT                   /translation="MRPLSPPRPTVRWELLERHLEEAEFLWTQWEHGLWSPELTLSSLA
FT                   EGDEGRLRAHLDALVLGGSAAATRLLLPALTSEDPARVASAAWALLSAEDADWREPVFQ
FT                   QLEQGSEETHPGLLRALELLDRPDLHALLLKKLPTLQPTLQAGALRVARVRHLDTSAAL
FT                   EKLDWEADPALHAEALRALPFAPRMQTGDARLSRALSHAHPTVSTAALETGLLLGSREA
FT                   WEHARGSASRGGLLALAVAGESKDLTGLLARLKDGSAPAEVIWAVGFSGRLLAAEALLP
FT                   LLRDEAQGPLAAASFAAITGLPMVPPFLVEAPADEEEDAEEAEPEAEDLQAWLPSPRVL
FT                   PGEVDAQAVEAWWTRRRGGFTEGARFLRGIPLTVEVLVRALETEPMRRRPSLAWEAALR
FT                   GGGTPQMESRQWTRVQREQALPLRGQRPEWLARAGSWPQGRRGDTPA"
     gtgaggccct tgtcgccgcc ccgtccaacg gttcgctggg agctgctgga gcgccacctc        60
     gaggaagccg agttcctgtg gacgcagtgg gagcacggcc tctggagccc ggagctcacc       120
     ctgtcctcgc tggccgaggg cgatgaaggg cgtctgcggg cccacctgga tgcactcgtg       180
     ttgggaggca gcgccgccgc cacccgcttg ctgctccccg cgctgacctc cgaggacccc       240
     gcgcgtgtgg ccagcgcggc gtgggccctg ctctccgccg aggacgccga ctggcgcgag       300
     cctgtgttcc aacagttgga gcaggggtcc gaagagacgc atccgggcct cctccgcgcg       360
     ctggagctgc tcgaccggcc ggacctccac gccctgctcc tgaagaagct gccgacgttg       420
     cagccaacgc tccaggcggg agcgctccgg gtcgcgcgcg tccgtcacct cgacacgagc       480
     gccgcgctcg agaagctcga ctgggaggcc gacccggcgc tgcatgccga ggcgcttcgt       540
     gcccttccct tcgctcccag gatgcagaca ggggatgctc ggctgtcacg cgccctgagc       600
     cacgcccatc ccaccgtgag caccgccgcc ctggagaccg ggttgctgct gggctcgcgt       660
     gaagcctggg agcacgcccg aggttccgcg tcgcgcggcg ggctcctcgc gctcgccgtg       720
     gcgggtgagt cgaaggacct cacgggcctc ctcgcgcgcc tgaaggatgg ctccgcaccg       780
     gcggaggtca tctgggcggt gggcttcagt ggcaggctcc tggcggccga ggcgttgctg       840
     ccgctgctgc gcgatgaggc ccagggcccg ctggccgcgg cctccttcgc cgccatcacc       900
     ggactcccca tggtgcctcc tttcctcgtg gaggcacccg ctgacgagga ggaggacgcg       960
     gaggaggccg aacccgaggc cgaggacctc caggcgtggc tccccagccc ccgggtgctt      1020
     cccggcgagg tggacgccca ggccgtggag gcctggtgga cgcggcggcg cggcggcttc      1080
     acggaaggcg cgcgtttcct gaggggcata cctctcaccg tggaggtgct ggtcagggcc      1140
     ctggagaccg agcccatgag acggcgcccc tcgctcgcct gggaggcggc cctgcgcggc      1200
     ggaggcacgc cccagatgga gtcccggcag tggacgcggg tgcagcgcga gcaggcgctt      1260
     cccctgcggg ggcagcgccc ggaatggctc gcccgggcag ggagctggcc gcagggccgc      1320
     cgaggcgaca ctcccgcctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page