(data stored in ACNUC30630 zone)

EMBL: CP000113.PE402

CP000113.PE402       Location/Qualifiers
FT   CDS_pept        477945..478718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0417"
FT                   /product="conserved domain protein"
FT                   /note="identified by similarity to GB:AAM32628.1"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF85"
FT                   /protein_id="ABF86023.1"
FT                   /translation="MSHAATFSERLVDAGRGLLTGVSSASVGVARSVGVVLKAMGGGVA
FT                   QCVRGRPREGLPQLGQGLTRVAQLPADAVLMVGGRVLSSVQVLVGLEPPGRRLSAEEIA
FT                   RLRPIFGDSLNYAVVRVKVGRLGLLGLPGRAFAHGNTVFVPPRSGGVDFGLLVHELTHV
FT                   WQHQHGGTAYLSAALAAQWSGDGYDWRKGVSREKRWAQLNPEQQAQLIEDAAVAGLIPF
FT                   TTSVSPRMKLRGWSDAALDLLDEAVVCLHSGRGAP"
     atgagccacg cggccacctt ctcagagcgg ctggtggatg cgggccgggg tctgctcacc        60
     ggtgtctcga gcgcgtcggt gggagtggct cgcagcgtgg gggtggtgct gaaggcgatg       120
     ggcggaggcg tggcgcagtg cgtgcgcggc cggcctcgcg agggactgcc ccaactgggc       180
     cagggcctga cgcgcgtggc gcagcttccc gcggatgccg tgttgatggt gggcgggcgc       240
     gtgctcagct cggtgcaggt gctggtcggt ctggagccgc cgggccgccg cctctcggcg       300
     gaggaaatcg cccgcctgcg gcccatcttt ggagacagcc tgaactacgc ggtggtgcgg       360
     gtgaaggtcg gtcggctggg cctgctgggc cttcccgggc gggccttcgc gcacggcaac       420
     accgtcttcg tcccgcctcg gagcgggggc gtggacttcg gcctgctcgt tcatgagctg       480
     acgcacgtgt ggcagcacca gcacggtggc acggcctacc tgagcgccgc gctggccgcg       540
     cagtggtccg gcgatggata cgactggcgc aagggcgtga gccgcgagaa gcgttgggcc       600
     cagctcaacc ccgagcaaca ggctcagctc atcgaggacg ccgccgttgc cggcctcatc       660
     cccttcacca cgtctgtgtc cccgcgcatg aagcttcggg gctggtccga cgcggcgctc       720
     gacctgctgg atgaggccgt ggtctgcctg cactcgggcc gcggcgcgcc ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page