(data stored in ACNUC30630 zone)

EMBL: CP000113.PE412

CP000113.PE412       Location/Qualifiers
FT   CDS_pept        487152..487328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88279"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF75"
FT                   /protein_id="ABF88279.1"
FT                   /translation="MHVMPESEDGLHQHKFFRTYDSMRDVAGVLIFEAQCLPFEAALHE
FT                   LLYAPCLKEEIPH"
     ttgcacgtca tgccggagtc cgaggacggg ctccatcaac ataagttctt ccgcacctat        60
     gacagcatgc gtgatgttgc cggcgtactc atcttcgagg cccagtgtct cccctttgaa       120
     gcggcgctcc acgaactgct ctacgcgcca tgtctgaaag aagagattcc ccactga          177
//

If you have problems or comments...

PBIL Back to PBIL home page