(data stored in ACNUC30630 zone)

EMBL: CP000113.PE413

CP000113.PE413       Location/Qualifiers
FT   CDS_pept        complement(487697..488458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF74"
FT                   /protein_id="ABF92426.1"
FT                   /translation="MAKVPRPAHAATLWGDRIKRVPSVVPVAEVLVPNACDATYAMDGD
FT                   RHWVHKRLLGADGLLAEALGLLLGQALGAPVPEGAVTGPPDDTTWLSEVIPDIQHWDRQ
FT                   LANFIVNYPDVGRLLALDAILLNDDRHEGNLVLQATAEHEYSRRAWGIDMANALAGRPT
FT                   DFAAAGMNTPSIAKLVDGIPVTLIQEGAMLAAVQAQSLSTYLVKSMVMEACSLSREPRE
FT                   TEDVLLGALLSRMARAPELVAEYLEKVGSRP"
     atggcgaagg tgccgcgacc agcgcacgca gcgacgcttt ggggcgaccg aatcaagcgg        60
     gttccaagcg tcgttccggt ggcggaagtg ctcgtcccca atgcgtgcga tgccacctac       120
     gcaatggatg gggaccggca ttgggtgcac aagcgcctac tgggcgccga tgggcttctt       180
     gcggaagcgc ttggtctcct gcttggtcaa gcgcttggcg cgcccgtccc ggagggagcc       240
     gtaacaggcc cgcctgacga caccacctgg ctcagcgaag tcatcccgga catccagcat       300
     tgggaccgtc agcttgcgaa cttcatcgtc aactatcccg atgtcggacg gctgctggca       360
     ctcgacgcca ttctcctcaa cgatgaccgc catgagggga acctcgtctt gcaggcgacg       420
     gcggagcatg agtactcgcg ccgtgcctgg ggcatcgaca tggccaatgc cctggctggt       480
     aggcccaccg acttcgctgc ggcgggcatg aatacgccga gcatcgcaaa gctcgtcgac       540
     gggattccgg tcacgctcat ccaagagggg gcaatgctgg ccgctgtcca ggcccagtcc       600
     ctcagcacct acctcgtgaa gtcgatggtg atggaggcct gctcgctctc tcgtgaaccc       660
     cgtgaaacag aggatgtgct cctgggtgcg ctcctcagtc gaatggcgcg tgcgccggag       720
     ctcgtagcag agtatcttga gaaagtaggt tcgcgcccat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page