(data stored in ACNUC30630 zone)

EMBL: CP000113.PE422

CP000113.PE422       Location/Qualifiers
FT   CDS_pept        complement(498689..499402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0438"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89952"
FT                   /db_xref="GOA:Q1DF65"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF65"
FT                   /protein_id="ABF89952.1"
FT                   /translation="METLVTRLLSLRVGMPRELGVTGAASPLERPWTSAIFKEPVTGPV
FT                   WLSRTGLAGDGQADRKVHGGPEKAVLAYPITHYDFWRERMARDDVGAGAFGENWVLSQG
FT                   TEADVCIGDVLRVGGARVQVSQPRQPCWKPARRWGQRDLSLLLQQTGRTGWYYRVLEEG
FT                   PVQEGDVVALLERPFPTFTIAFANHAMHGHAPEDAALLAECPLLTPNWRDSLRRRAQGS
FT                   RGDDRPRLVGPNSAD"
     atggagaccc tcgtgacgcg cttgttgtcg ctgcgagtgg gcatgccccg ggagctgggc        60
     gtcaccggtg ccgcctcgcc actggagcgg ccctggacca gcgccatctt caaggagccg       120
     gtgacagggc cggtgtggct gtcacgcacg gggctcgccg gagatggcca ggcggaccgc       180
     aaggtccacg gcggaccgga gaaggcggtc ctcgcctatc ccatcacgca ctacgacttc       240
     tggcgcgaac gcatggcgcg agacgacgtc ggcgcgggcg cattcggtga gaactgggtg       300
     ctctcccagg gcacggaagc ggacgtctgc atcggagacg tgctgcgcgt gggcggcgca       360
     cgcgtgcagg tatcccaacc tcgccagccc tgctggaagc ccgcgcgccg ctggggacag       420
     cgcgacctgt cgctactgct ccagcagacc ggccgcaccg gctggtacta ccgcgtgctg       480
     gaggaagggc ccgtccagga aggcgacgtg gtggcgttgc tcgagcggcc cttccccacc       540
     ttcaccatcg ccttcgccaa ccacgccatg cacggccacg cgccggagga cgccgcgctg       600
     ctggcggagt gtcccttgct gacgccgaac tggcgtgact cgctccgcag gcgcgcgcag       660
     ggtagtcggg gagatgaccg cccgcggctg gtgggaccca acagcgccga ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page