(data stored in ACNUC30630 zone)

EMBL: CP000113.PE434

CP000113.PE434       Location/Qualifiers
FT   CDS_pept        complement(513060..514295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0450"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM PF04138"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88769"
FT                   /db_xref="GOA:Q1DF53"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF53"
FT                   /protein_id="ABF88769.1"
FT                   /translation="MAWLTGNLSPSARIWTALAPAIVACTYFIGGLLLFCIRCAFKGIP
FT                   RDEETLKRGSNGLVGFFLRHYFFWVIQPLWAVILRSGLPANALSMLSGLLGISSGVAVA
FT                   AGRFALGGWLFLFAGILDVMDGRIARTRKEANPAGAALDSVLDRYVDSAMLMGLAWYYR
FT                   DTWVLLPALMALLGSSLVPYVRAKGEGLGVNVRDGAMQRLERVLFMGAGTALSPILEAV
FT                   FWPEEKHPMHWLAVVGLVFVAVMSNVTALSRFRNLVKALAPKRQEARSGKAIIGLNALA
FT                   GAVATAVDFALVLALVEWAGVLPAWATVLGCGLGAVVNYSINRVLTFKSTGAVGRQLAR
FT                   YSVVSGTSALLNAGGVALLTLHPQLAYALGWWLVRGVVYFAWNLPLQRDYVFNNDAAAS
FT                   EDALMEQRPHAA"
     atggcgtggt tgaccggaaa cctgtctccg tccgcccgca tctggacggc gctggcaccg        60
     gccatcgtcg cctgcacgta cttcatcggc ggcttgctcc tcttctgtat ccgctgcgcc       120
     ttcaagggca ttccccgcga cgaggagacg ctcaagcgcg gcagcaacgg gctggtgggc       180
     ttcttcctgc ggcactactt cttctgggtc atccagccgc tgtgggcggt gattctgcgc       240
     tcgggtctgc cggccaacgc gctgtccatg ctgtcgggcc tgctgggcat ctcttccggc       300
     gtggcggtgg cggcgggccg cttcgcgctg ggcgggtggc tcttcctgtt cgcgggcatc       360
     ctggacgtga tggacgggcg catcgcccgc acgcgcaagg aggccaaccc cgcgggcgcg       420
     gcgctggact cggtgctgga ccggtacgtg gactcggcga tgctcatggg cctggcctgg       480
     tactaccggg acacctgggt gctgctgccc gcgctgatgg cgctgctcgg ctcctcgctg       540
     gtgccctacg tgcgcgccaa gggcgaaggc ctgggcgtca atgtgcgcga cggcgccatg       600
     cagcggctgg agcgggtgct cttcatgggc gcgggcacgg cgctgtcgcc catcctggag       660
     gccgtcttct ggcccgagga gaagcacccc atgcactggc tcgcggtggt ggggctcgtc       720
     ttcgtggccg tcatgagcaa cgtcacggcg ctctcccgct tccgcaatct ggtgaaggcg       780
     ctggcgccca agcgtcagga ggcgcgctcc ggcaaggcca tcatcgggct caacgccctg       840
     gcgggcgcgg tggccacggc ggtggacttc gcgctggtgc tggcgctggt ggagtgggcg       900
     ggcgtgctgc ccgcctgggc cacggtgctg ggctgcggcc tgggcgcggt ggtgaactac       960
     tccatcaacc gggtgctcac cttcaagagc accggcgcgg tggggcggca gctggcgcgc      1020
     tactcggtgg tgagtggaac cagcgcgctg ctcaacgcgg gcggcgtggc gctactgacg      1080
     ctgcacccgc agctggccta tgcgctgggg tggtggctgg tgcgcggcgt ggtgtacttc      1140
     gcgtggaacc tgccgctgca gcgtgactac gtcttcaaca acgacgcggc ggcttccgag      1200
     gacgcgctca tggagcagcg cccccatgcg gcctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page