(data stored in ACNUC30630 zone)

EMBL: CP000113.PE444

CP000113.PE444       Location/Qualifiers
FT   CDS_pept        523979..524746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0460"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89383"
FT                   /db_xref="GOA:Q1DF43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF43"
FT                   /protein_id="ABF89383.1"
FT                   /translation="MMEDVAVAPARILLVDDEESLRITLAANLELEGHTVLEAANGEEA
FT                   LRLLEKQSVDVVLTDIRMPGLHGVELLRRIKQERPDMPVVLMTAFTAEELVDDALAEGA
FT                   FTVLPKPFDVTHALDTVLRAAAAPQVLVVDDTEQVARGMVRALSTVGLRARAVYSGEEA
FT                   LASLRSGEYDVCVLDLVMPEMSGPELVSKVRAANLSVAIIAVSGHVVPEMLRRVAAQGA
FT                   VVCMTKPVPLRELVQAIARVRGRPQQGLQGARI"
     atgatggagg acgtcgcagt ggcccccgcg cgcatcctgc tggtcgacga cgaggagtcg        60
     cttcgcatca ccttggccgc gaacctggag ctggagggcc acacggtcct cgaggcggcc       120
     aatggtgagg aggccttgcg cctcctggag aagcaatccg tggacgtggt gctcacggac       180
     atccgcatgc ccggcctgca cggcgtggag ctcttgcgcc gcatcaagca ggagcgcccc       240
     gacatgccgg tggtgctgat gacggccttc acggcggagg agctggtgga tgacgcgctc       300
     gccgagggcg ccttcaccgt gctgcccaag cccttcgacg tgacgcacgc gctggacacg       360
     gtgctgcgcg cggcggcggc gccgcaggtc ctggtggtgg acgacaccga acaggtggcg       420
     cgcggcatgg tgcgcgccct gagcacggtg gggctgcgcg cgcgcgccgt gtacagcggc       480
     gaggaggcgt tggcctcgtt gcgttcgggg gaatacgacg tctgcgtgct ggacctggtg       540
     atgccggaga tgagcgggcc ggagctggtg tccaaggtgc gcgcggcgaa cctgtccgtc       600
     gccatcatcg ccgtgtctgg ccacgtggtg ccggagatgc tccgcagggt ggcggcgcaa       660
     ggcgcggtgg tgtgcatgac caagccggta ccgttgcgcg agctggtgca ggcgattgca       720
     cgggtgcgag gccggcctca acaagggctg caaggcgcga ggatttga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page