(data stored in ACNUC30630 zone)

EMBL: CP000113.PE446

CP000113.PE446       Location/Qualifiers
FT   CDS_pept        525475..525858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0462"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91004"
FT                   /db_xref="GOA:Q1DF41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF41"
FT                   /protein_id="ABF91004.1"
FT                   /translation="MMETNWTFGRCLLLVEDDPSNRMTLSALLEDAGFAVVTAGSYSEA
FT                   AGLLNRPRAYDAVLLDQSLGDGFGTGLIPLVRHHMPKTKVVFVTGHDGKIDMPVDAVFR
FT                   KGGHFDDLLAFLFKLLPQRPLGA"
     gtgatggaga cgaactggac gttcgggcgt tgcctgctgc tcgtggaaga cgacccttcc        60
     aaccggatga cgctgtccgc gcttttggag gatgcgggct tcgcggtcgt caccgccggc       120
     tcctattcgg aggccgcggg attattgaac cggcctcggg cgtatgacgc cgtgctgttg       180
     gaccagagcc tgggtgacgg ctttgggacg gggctgattc cgctggtgcg ccaccacatg       240
     ccgaagacca aggtcgtctt cgtcaccggt catgacggga aaatcgacat gccggtggac       300
     gccgtcttcc gcaagggcgg ccacttcgac gacctgctgg ccttcctttt caagctgttg       360
     ccccagcgcc cgctgggtgc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page