(data stored in ACNUC30630 zone)

EMBL: CP000113.PE450

CP000113.PE450       Location/Qualifiers
FT   CDS_pept        528601..530181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0466"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89948"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF37"
FT                   /protein_id="ABF89948.1"
FT                   /translation="MDELLSGAEGQFRTQGKGTPGALEPRGTVSVSEALEGDLDAYLDR
FT                   ELLEACEDDAAVEDPAPVTDVSARMRALLALAEEETEWLERLPLSTSRALDVLPEPTVE
FT                   IPEWMRTSPGAKKVTSLGALLPPRAENVLARAPDAPMWGDAPPHAHLESARWRAASATE
FT                   TVSVLGLRPGELMGAAAVGALAAGLLLVAGLYVRGGDSTGTQASVDDAIRRTAHGAVLG
FT                   TSGDAQAGLSSAGAGAAMRTAASSGHAIGASTSTQAAVSGSSPDAALAASSHVSGAASS
FT                   MAVSSTQPGIGSALLRDAAKGLRASVPASEPARSPGTPVAESLAVVSPAPFKRKAPAKP
FT                   DEAAALPPAPVELDFGDTGAAGAASQDAIATSPGDVAAEAVEEDTSEKGPYADLDEAFA
FT                   RELGFTEDADAELSKAEAPARTVYVPPAVDVKEHLTPEDVKQVVLTNQPAITACLRSHA
FT                   QGTPMEAGGRFMVQWSVLPSGETLNVSMDTAALRATLLSRCIEDVVRRWKFPVHQVRMQ
FT                   EPIRFPFIF"
     gtggacgagc ttctttccgg agctgaaggg cagttccgta ctcagggcaa aggcactcca        60
     ggtgcgttgg agccgcgcgg cacggtgagc gtgagcgagg cgctcgaggg agacctcgac       120
     gcgtatctcg accgtgagct tctcgaggca tgtgaagacg acgcggccgt ggaagaccct       180
     gcacccgtga cggatgtttc cgcgagaatg cgcgcgctgc tcgcactcgc ggaggaggag       240
     acggaatggc tggagcgcct gccgctgtcc acctcgcgcg cgctggacgt gttgcccgag       300
     cccacggtgg agattcccga gtggatgcgc acttcgcctg gagcgaagaa ggtgacgtcc       360
     ctgggcgcct tgttgccgcc gcgtgcggag aatgtgctgg cgcgtgcgcc ggatgcgccc       420
     atgtggggtg atgcgccgcc gcatgcgcac ttggaatccg cgcggtggcg cgctgcgagc       480
     gcgaccgaga cagtcagtgt cctgggactt cgccccgggg agttgatggg cgcggcggcc       540
     gtgggcgcgt tggcggcggg cctgctgctg gtcgcgggac tctacgtgcg tggtggtgac       600
     tccacgggga cgcaggcgag cgtcgatgat gccatccggc gcacggcgca cggcgctgtc       660
     cttggcacga gcggtgacgc ccaggcgggc ctgtcgtcgg ctggcgccgg cgccgcgatg       720
     cgcaccgccg cttcgtctgg gcacgccatt ggagcgagca cgtccacgca ggccgccgtg       780
     agcggttcat cgccggacgc ggcgctcgct gcctcgtcgc acgtctcggg tgccgcgtcg       840
     tccatggctg tctccagcac gcagccgggc attggttcgg cgcttcttcg ggatgcggcg       900
     aagggactgc gcgcctccgt gcctgcctcg gagccggcgc gaagcccggg cacgcccgtg       960
     gcggagtcgc tcgcggtggt gagccccgcg cccttcaagc gcaaggcccc ggcgaagcca      1020
     gacgaggcgg cggctctgcc tcccgcgccc gtcgagctcg acttcggaga cacgggtgcg      1080
     gcaggcgccg cgtcccagga cgccatcgcg acgtcaccgg gtgatgtcgc cgcggaggcc      1140
     gtggaggagg acacgtcgga gaaggggccg tacgcggacc tcgatgaggc cttcgcgcgc      1200
     gagctgggct tcacggaaga cgcggacgcg gagctctcga aggcggaggc gcccgcgcgc      1260
     accgtctacg tgccgccggc ggtggacgtg aaggagcacc tcacgccgga ggacgtgaag      1320
     caggtggtgc tgacgaacca gcccgccatc accgcgtgcc tgcgttcaca cgcgcagggc      1380
     acgccgatgg aggccggtgg ccgcttcatg gtgcagtggt cggtgctccc cagcggtgag      1440
     acgctcaacg tgtccatgga caccgccgcg ctgcgcgcca cgctgctgtc gcgctgcatc      1500
     gaggacgtgg tgcgccgctg gaagttcccg gtgcatcagg tgcggatgca ggagcccatc      1560
     cgcttcccct tcatcttctg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page