(data stored in ACNUC30630 zone)

EMBL: CP000113.PE457

CP000113.PE457       Location/Qualifiers
FT   CDS_pept        535425..535874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0473"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90680"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF30"
FT                   /protein_id="ABF90680.1"
FT                   /translation="MGQYLSRCRRVTLAPPSKGGRFMSHSYSKVFGALVLLGLAVSCRA
FT                   NHAPKVSTGPRPSPQVVGAGGVVSFVFEVEDPDGDAMTFQWQQLPAEPAGTFSDANARN
FT                   PTWVAPEVSETTTFAIMVTVEDSEGDGILAQGPGVIVHAAASQAP"
     gtggggcaat acctctcccg atgcaggcgc gttactctgg cgccaccatc caaagggggc        60
     cggttcatgt ctcactcgta ctcgaaagtg ttcggggcgc tggtgctgtt ggggctcgct       120
     gtgtcctgcc gggccaatca cgctcccaag gtctccacgg ggcctcggcc ttcgccgcag       180
     gtcgtcgggg cggggggcgt ggtgtccttc gtcttcgagg tcgaagaccc ggacggggac       240
     gccatgacct tccaatggca gcagctcccc gcggagcccg cgggcacctt cagcgacgcg       300
     aatgcgcgca accccacgtg ggtggcgccg gaagtgtcgg agacgacgac cttcgccatc       360
     atggtcaccg tggaggacag cgagggcgat ggcatcctgg cccaggggcc gggcgtcatc       420
     gtccacgcgg cggcgtccca ggcgccctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page