(data stored in ACNUC30630 zone)

EMBL: CP000113.PE466

CP000113.PE466       Location/Qualifiers
FT   CDS_pept        complement(541537..541929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93019"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF21"
FT                   /protein_id="ABF93019.1"
FT                   /translation="MGARWRRAAQVGWLAFALCGAAAVVRASTAELPPRERTLNAAERK
FT                   LVGRAAASQEPEWRRKSRQSFPGDRWSQDDDFGASERQWALDEARRRRVPVTDVLGAID
FT                   EELHGQPVLPPRKATASPCKPRPFYD"
     atgggtgcaa ggtggcgtcg agcggcacag gtcgggtggc tggctttcgc gctgtgcggt        60
     gccgccgcgg tggtgcgcgc ctccacggcc gagctgccgc cgcgcgaacg caccctgaac       120
     gcggccgagc gcaagctggt gggccgcgcc gccgcgagcc aggagccgga gtggcgccgc       180
     aaatcgcgcc agtccttccc cggcgaccgc tggtcccagg acgatgactt cggcgcgtcc       240
     gagcgccaat gggcgctgga cgaggcccgc cgccgccgcg tgccggtgac ggacgtcctg       300
     ggcgccatcg acgaggagct gcacggccag cccgtgctgc ccccgcgcaa ggccaccgcc       360
     agcccctgca agccccgccc cttctacgac tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page