(data stored in ACNUC30630 zone)

EMBL: CP000113.PE468

CP000113.PE468       Location/Qualifiers
FT   CDS_pept        complement(543838..544407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF19"
FT                   /protein_id="ABF90466.1"
FT                   /translation="MPKRYFRLKEDMQAENWDLGDPLDEKGQEVDDPYLFAAGQPVRVA
FT                   GRLTIPVDAPGRRLDFGTAGIGAAPIVHVRVATLFAELAPDDVQLIPVDIQGHPDQYLI
FT                   LVATKRIRCIDDEACEEVRYWKPEHGQPERIGDYKSVMGLRIDASKVGAAKVFRTEGWD
FT                   IALIVSEDIKKALERAKATGAKFTQV"
     atgcccaagc gctacttcag gctcaaagag gacatgcaag ccgagaactg ggacctggga        60
     gaccccctgg acgagaaagg ccaagaggtg gacgacccct acctatttgc ggccggacag       120
     cctgttcgtg ttgcaggccg actgacgatt cccgtcgacg cgcccgggag gcgattggac       180
     ttcggcaccg cgggcatcgg cgctgcacct atcgtccatg tccgggtggc caccctcttc       240
     gcggagctag cccccgacga cgtgcagctc atccccgtgg acatccaggg ccatccggac       300
     cagtacctca tcctggtggc cacgaagcgc atccgctgca ttgacgacga agcgtgcgag       360
     gaggtgcgct actggaagcc ggagcatggg cagccagagc ggattggcga ctacaaatcg       420
     gtgatggggc tgcgcatcga cgcctcgaag gtgggcgccg cgaaggtctt ccgcacggaa       480
     ggctgggaca tcgccctcat cgtgtccgag gacatcaaga aggccttgga gcgcgcgaag       540
     gctaccggcg cgaagttcac gcaggtgtag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page