(data stored in ACNUC30630 zone)

EMBL: CP000113.PE470

CP000113.PE470       Location/Qualifiers
FT   CDS_pept        546168..546998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89882"
FT                   /db_xref="GOA:Q1DF17"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF17"
FT                   /protein_id="ABF89882.1"
FT                   /translation="MGLGPPSLHTRRAQRAAAYSRINVILYIRTRGWRHSKTMTFSETW
FT                   DLAWSILLSIGSAGGLILGLSNWLGKVWANRILEREKLAIQRELQALQAESAQRLHALK
FT                   ERTDVLLKNLEAEHSRRHRVHNLQFAKEFQLYADTWKALHALKIKTLTLRPVGDVVDVR
FT                   ETEEERRERRYKEFAEAFNAAVSVIAENEPFFPQEVFAKIRELQSLSRREAFSYYYKGR
FT                   QKKGVDMKYWEEAEENQQQIVEQVDAICEAIRTRIGLIEIVEGPQGVAPSVPPL"
     atgggcttgg gtccaccctc actgcatacg cggcgagccc agcgtgctgc cgcctatagt        60
     cgcatcaatg tgatacttta tatccgcaca cgcggttgga ggcactcgaa gaccatgacg       120
     ttctcggaaa cgtgggattt ggcttggtcc attctcctct ccatcggcag cgcgggcggc       180
     cttatccttg ggctgtcgaa ctggcttggg aaggtttggg ccaaccgcat ccttgagcgt       240
     gaaaaactcg ccatccagcg ggaactccaa gcactgcagg cggagtccgc gcagcgtctt       300
     cacgcgctga aggagcgcac ggacgttctc ctaaagaacc ttgaggctga gcactcacga       360
     aggcaccgag tgcataacct gcagttcgcg aaggagtttc agttgtacgc cgacacatgg       420
     aaggcgctcc acgccttgaa gataaagact ctgacgctcc ggccagtcgg tgacgtggtg       480
     gatgtgcgcg aaacggagga ggagcgtcga gagcgacgat acaaggagtt tgccgaggct       540
     tttaatgcag cagtgagtgt aatagcggag aacgagccct ttttccccca agaggtcttc       600
     gcaaaaatcc gcgaattaca gtccctatcc aggcgggaag cattctcgta ctactacaag       660
     ggccgacaga agaagggtgt cgacatgaag tactgggaag aagcagaaga gaatcagcag       720
     caaattgtag agcaggttga tgccatctgc gaagccatcc ggaccaggat tggacttatt       780
     gagatcgtcg aggggcctca aggagtcgca ccatcagtgc cgcctcttta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page