(data stored in ACNUC30630 zone)

EMBL: CP000113.PE478

CP000113.PE478       Location/Qualifiers
FT   CDS_pept        552681..553145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0494"
FT                   /product="cation-binding protein, hemerythrin HHE family"
FT                   /note="identified by match to protein family HMM PF01814"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92946"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF09"
FT                   /protein_id="ABF92946.1"
FT                   /translation="MEVIDLLIQQHREVDALFLAFRNASDDTSRRDLCIQLAEALMLHS
FT                   TIEARWGSPKASRVVGDEKIEHAEQEHQEMTKLLGDIVRMRDDMNAVKAKVGALEKVVK
FT                   RHIADEEKNILPQVARNITEKDLGMSCKDLVREASRIRREEMRDWGGASL"
     gtggaggtca tcgacctgtt gattcagcag caccgcgaag tcgacgcgct gttcctggcg        60
     ttccgcaacg cctcggacga cacgagccgc agggacctgt gcatccagct cgcggaggcg       120
     ctcatgctgc actccaccat cgaggcgcgc tggggctccc cgaaggcctc gcgggtggtg       180
     ggcgacgaga aaatcgagca cgcggagcag gagcaccagg agatgacgaa gctcctgggt       240
     gacatcgtgc ggatgcgcga cgacatgaac gcggtgaagg ccaaggtcgg cgcgctggag       300
     aaagtggtca agcgacacat cgcggacgag gagaagaaca tcctcccgca ggtggccagg       360
     aacatcaccg agaaggatct cggcatgtcc tgcaaggacc tggtccgcga ggcctcccgg       420
     attcggcgtg aggagatgag agactggggc ggcgcgtccc tctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page