(data stored in ACNUC30630 zone)

EMBL: CP000113.PE479

CP000113.PE479       Location/Qualifiers
FT   CDS_pept        553256..553453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0495"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91663"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DF08"
FT                   /protein_id="ABF91663.1"
FT                   /translation="MNQNVLPRPGALTTATLPRANPARVFATWSDVETKAQWFIGPHER
FT                   WTPVKRERPSSRCAGGERWA"
     gtgaaccaga acgtgctgcc ccgacctggc gcgctgacca cggccacatt gccgcgagcc        60
     aatccagccc gagtcttcgc gacctggtcc gatgtggaga ccaaggccca gtggttcatc       120
     ggtccgcacg agcggtggac gcccgtgaag cgcgagcgtc cctcaagcag gtgcgcagga       180
     ggcgagcgct gggcatga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page