(data stored in ACNUC30630 zone)

EMBL: CP000113.PE491

CP000113.PE491       Location/Qualifiers
FT   CDS_pept        complement(567243..568094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92994"
FT                   /db_xref="GOA:Q1DEZ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEZ6"
FT                   /protein_id="ABF92994.1"
FT                   /translation="MGHVPMAGLAVPSWELALGAAVHAVAHTASRLRPRHTRGPEHEHR
FT                   SPRASPGLMPLLGRDVQHGGLRVRLLANPRGSCARCEGVHAMETMATALRRYFDESGFG
FT                   EDGGYASDWVDFKLGPLPFPLPNTEARKRAVRFHDLHHVLTGYRTDLTGEFEISAWEIG
FT                   AGCGDFHAAWVLNLSGMTGGLLTAPVRTWRAFVRGLDEQSTYGRDYEALLERNVEDLRA
FT                   ELGIGAGPHRAGLGAALRFAAAITAGAVVGSLMMLVLVSPITLALWWRGRRAKAQALAA
FT                   AP"
     gtggggcacg tccccatggc cggccttgct gttccgagtt gggaactcgc gctcggtgcc        60
     gccgttcacg cggtcgcaca cacggcgtcc cgcctgaggc ccaggcacac ccgcgggccg       120
     gagcatgagc accggtcccc gcgcgcatcg ccgggcctga tgcctctcct cggacgcgac       180
     gtgcagcacg gaggtctccg cgtcagactc cttgcgaacc cgcggggcag ctgcgcccgc       240
     tgcgagggag tccatgcgat ggagaccatg gccacggcgc tgcgacgcta cttcgacgag       300
     agcggcttcg gagaggacgg cgggtacgcg tccgattggg tcgacttcaa gctcggcccc       360
     ctccccttcc cgctccccaa caccgaggct cgcaagcgcg cggtgcgctt ccacgatctg       420
     caccacgtcc tcaccggcta tcgcaccgac ctcacgggcg agttcgagat ctccgcgtgg       480
     gagatcggcg cgggctgcgg cgacttccac gcggcctggg tgctcaacct ctcgggcatg       540
     accggggggc tgctgacggc cccggtgcgc acctggcgcg cgttcgtccg cgggctcgac       600
     gagcagtcca cctacgggcg cgactacgag gcgctgctcg agcgcaacgt cgaggacctg       660
     cgcgcggagc tcgggatcgg agcgggtccc caccgagcgg gcctcggcgc cgcgcttcgc       720
     ttcgccgcag cgatcactgc gggcgcagtg gtcggctcgc tgatgatgct ggtgctcgtc       780
     tctcccatca ccctggcgct ctggtggcgg ggccgaaggg ccaaggccca ggcgctggcc       840
     gccgcgccct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page