(data stored in ACNUC30630 zone)

EMBL: CP000113.PE5

CP000113.PE5         Location/Qualifiers
FT   CDS_pept        complement(4634..5485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0005"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91414"
FT                   /db_xref="GOA:Q1DGD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD2"
FT                   /protein_id="ABF91414.1"
FT                   /translation="MSAEVPSGALPRCALHPDALAGATCQRCGSFVCTECTTWVMGRMY
FT                   CPACAVRPEVNYLEAFRLKLWGRRDASAWLVVGVTVVLVGLALVALMAGDVGTTLACLG
FT                   SSGVGVAFFLGMRWARMGLLAVPLLAMLLTAQSLGAPALLFFIPLMVAVNVFRDTRSRL
FT                   FFRLDVPERELRQLWDLRVNNPLARHALSLSVGSLFLPVFAPLLSYFGVWSALTFVFAG
FT                   LSMLALILGLVALRRVDPEARPPIGRRWEALGAVCLALVALALWGVLHRTRMVELLGGA
FT                   VD"
     atgtccgccg aagtcccatc cggggccctg ccccgctgcg ccctccatcc ggatgcgctc        60
     gcgggcgcca cctgccagcg ctgtggcagc ttcgtctgca ccgagtgcac gacgtgggtg       120
     atgggccgca tgtactgccc tgcctgcgcg gtgcgtccgg aggtgaacta cctggaggcc       180
     ttccggctca agctctgggg acggagggac gcgagcgcct ggctggtggt cggtgtcacg       240
     gtggtgctcg tcgggctggc gctggtggcg ctgatggccg gggacgtcgg caccacgctg       300
     gcgtgcctgg gcagctcggg cgtgggcgtg gcgttcttcc tgggcatgcg gtgggcgcgc       360
     atgggcctgc tcgccgtgcc gctgctggcg atgctgctca ccgcgcagtc cctgggcgcg       420
     cccgcgttgc ttttcttcat tcccctcatg gtcgcggtga acgtctttcg cgacacacgc       480
     agccggctct tcttccgcct ggatgtcccc gagcgcgagc tacgccagct atgggacctg       540
     cgggtcaaca acccccttgc tcggcatgcg ctgtcgctga gcgtggggtc gctgttcctg       600
     cccgtgttcg cgccgctgct ctcctacttc ggggtgtgga gcgcgctgac attcgtcttc       660
     gcggggttgt ccatgctcgc cctcatcctg ggcctggtgg cgctgcggcg ggtggacccg       720
     gaggcacggc cgcccattgg ccggcggtgg gaggcgctcg gcgcggtgtg tctggcgttg       780
     gtcgcgctgg cgctctgggg cgtgttgcac cggactcgga tggtggagct gctcggcggc       840
     gcggtggact ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page