(data stored in ACNUC30630 zone)

EMBL: CP000113.PE501

CP000113.PE501       Location/Qualifiers
FT   CDS_pept        complement(577397..580273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0518"
FT                   /product="putative TonB-dependent receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91284"
FT                   /db_xref="GOA:Q1DEY6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY6"
FT                   /protein_id="ABF91284.1"
FT                   /translation="MDLSPQRGKNAWRPMRSSRSFAFVLSVFLLSAPVLADNNADEADI
FT                   AFELGNDAYSKGQYAEALRSYFTSYRLVPNRNVLFNIARCFEALGKFNEAYRYYNDLLA
FT                   EDLPKEDAAEVSRSVDRLRPKVALVRVTSNPKGADVYVDRMDLGSRGRSPQTLALTPGR
FT                   HKIMVKKEGYRAAEATLTLVRGRETDQTFDLTLITGGVEVTGTPEGAEIRDAPNGNILA
FT                   RVPGRVRLPPGQRVLHVRAPGYAPSQYVVDVPADGNVPVAVALRPQDRPTGRLVVTANR
FT                   DGATVRVDGKPAGFTPTVVTLPEGEHTLEVESREVRPLRQTVKVVADEEVKVHAELRYA
FT                   PPPVRAASKSLVAVDEAPASTTVLTQEELRAFGWRTVAEAVAGVRGFYLTDDRTYTYMG
FT                   VRGFSPPGDLNTRILILWDGHSMNDVWAGQGFAARDLSVDIQEVERIEVVRGPGSALYG
FT                   TGAFFAVINVVPRESLGSDKHLEVTGAVGALGTTRGHAAASWEDGNRSVLVSAAALTST
FT                   GADTTRLGSSGPIITGLDAERAAGGSLRARVGDLSFQAQFNVRTKELPTAPYGTVPGTE
FT                   GNIVEDMRAFAEARYERQFTERFSLSVRGAFDISRYEGTYVYPEEDGGARTEGGAADWL
FT                   TAEARARIGLFEGNVFTLGVEGQAQLRVRQDAGDLPLETQARTLVSAYLLDEWKIHPRL
FT                   SVSAGLRLDKYVDLDSTPITPRLAVIARPYERGLTKLVAGNAFRAPNVYELYYADGISQ
FT                   GAALNLRPETITTFELEHSHDLTDELRLTVAGYHNRISSLVQLTAEDAASGDCGTAACL
FT                   RFMNTDGTTLAWGAEAGVHWQPGRWLMVDVSYSYVTLRNASEEVANAAPAHLVAGRMML
FT                   PIGAGDMRVATQAIYQSARPTGPGGADSGEALLVGFGLSGDYGPLRYFAGVHNLLDARY
FT                   SLPVSDENSIAPVPQYGRTFTLQLTGTF"
     atggacctct caccccagag agggaagaat gcttggcgtc ccatgcgttc ctcccgttct        60
     ttcgcgttcg tcctctcggt gttcctcctg tccgcgcccg tgctcgcgga caacaacgcg       120
     gatgaagcgg acatcgcgtt cgagctcggc aacgatgcct attccaaggg gcagtacgcc       180
     gaggcgttgc gctcctactt caccagctac cgcctggtgc ccaaccggaa cgtcctcttc       240
     aacatcgccc gctgcttcga ggcgctgggc aagttcaacg aggcgtaccg ctactacaac       300
     gacctgctcg ccgaggactt gcccaaggag gacgccgccg aggtctcccg ctccgtggac       360
     cggctccgtc ccaaggtcgc gctggtgcgc gtcacctcca accccaaggg cgctgacgtc       420
     tacgtggacc gcatggacct gggcagtcgg ggccgctctc cacagacgct cgcgctgacg       480
     cccggccgtc acaaaatcat ggtgaagaag gaaggctacc gcgctgcgga ggccacgctc       540
     accctggtgc gcggccgtga gacggaccag accttcgacc tcacgctcat caccggcggc       600
     gtggaggtga cgggcacgcc ggagggcgcc gagattcgcg acgcccccaa cggcaacatc       660
     ctggcccgcg tgcccggccg cgtgcgactg cctcccggcc agcgcgtgct gcacgtgcgc       720
     gcccccggct acgcgcccag ccaatacgtg gtggatgtcc ccgccgacgg caacgtgcct       780
     gtcgccgtgg cgctgcgtcc ccaggaccgg cccaccgggc ggctcgtcgt caccgccaac       840
     cgcgacggcg ccacggtgcg cgtggatggc aagcccgccg gcttcacccc caccgtcgtc       900
     accctccccg aaggcgagca cacgctggag gtggagagcc gcgaggtgcg gccgctccgc       960
     cagacggtga aggtggtggc cgatgaagaa gtgaaggtcc acgccgagct gcgctacgcg      1020
     ccgcctccgg tgcgcgccgc atcgaagagc ctggtcgccg tcgacgaagc gcccgcctcc      1080
     accaccgtgc tcacacagga ggagctgcgc gccttcggct ggcgcaccgt cgccgaggcc      1140
     gtggccggtg tgcgcggctt ctatctcacc gacgaccgga cctatacgta catgggcgtg      1200
     cgcggcttct ccccgccggg cgacctcaac acgcgcatcc tcatcctctg ggatggccac      1260
     tccatgaacg acgtctgggc cggccagggc ttcgccgccc gcgacctcag cgtggacatc      1320
     caggaagtgg agcgcatcga ggtggtgcgc ggccctggca gcgccctgta cggcacgggc      1380
     gccttcttcg ccgtcatcaa cgtggtcccc cgtgaatcgc tgggttcgga caagcacctg      1440
     gaagtcacgg gcgcggtggg cgcgctcggc accacccggg gacacgccgc cgcgtcgtgg      1500
     gaggacggca accggtcggt gctggtgagc gccgccgcct tgacgtccac gggcgcggac      1560
     accacccggc tgggctccag cggtcccatc atcaccgggc tggacgcgga gcgcgccgcc      1620
     ggtggctccc tccgggcccg cgtgggcgac ctgtccttcc aggcccagtt caacgtgcgc      1680
     accaaggagt tgcccaccgc gccctacggc accgtgcccg gcacggaggg caacatcgtg      1740
     gaggacatgc gcgccttcgc cgaggcccgc tacgagcgcc agttcaccga gcgcttcagc      1800
     ctgtccgtgc gcggcgcgtt cgacatcagc cgctacgagg gcacctacgt ctacccggag      1860
     gaggacggcg gcgcccggac cgagggcggc gcggcggact ggctcaccgc cgaggcacgc      1920
     gcgcgcatcg gcctgttcga gggcaacgtc ttcacgctcg gcgtggaagg tcaggcgcag      1980
     cttcgcgtcc ggcaggacgc cggtgatttg cccttggaga cacaggcgcg cacgctggtg      2040
     tccgcgtacc tgctcgacga gtggaagatc cacccacggc tgagcgtgtc agccggcctg      2100
     cgtctggaca agtacgtgga cctggacagc acgcccatca ccccgcgcct ggccgtcatc      2160
     gcccggccct acgagcgggg cctcaccaag ctggtggcgg gtaacgcctt ccgcgcgccc      2220
     aacgtctacg agctctacta cgcggacggc atctcccagg gcgcggcgct gaacctgcgg      2280
     ccggagacca tcaccacctt cgagctggag cactcgcacg acctgacgga cgagctgcgc      2340
     ctcaccgtcg cgggctacca caaccgcatc tccagcctgg tgcagctcac tgcggaggac      2400
     gcggcttcag gcgactgcgg caccgccgcc tgtctgcgct tcatgaacac cgacggcacg      2460
     acactcgcct ggggcgccga ggccggcgtg cactggcagc cgggccgctg gctgatggtg      2520
     gacgtgagct actcctacgt gacgctgcgc aacgcctcgg aggaagtggc caacgcggcg      2580
     cccgcgcacc tggtggcggg ccggatgatg ctgcccattg gcgccggcga catgcgcgtg      2640
     gccacccagg ccatctacca gagcgcccgg cccaccggcc cgggcggcgc ggacagcggc      2700
     gaggcgctgc tggtgggctt cggcctgtcg ggtgactacg gccccctgcg ctacttcgcc      2760
     ggcgtgcaca acctgctgga cgcccgctac tcgctgccgg tgtcggacga gaactccatc      2820
     gcccccgtgc cccagtacgg ccgcaccttc acgcttcagc tcacggggac tttctga         2877
//

If you have problems or comments...

PBIL Back to PBIL home page