(data stored in ACNUC30630 zone)

EMBL: CP000113.PE506

CP000113.PE506       Location/Qualifiers
FT   CDS_pept        588233..590113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0523"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92036"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEY1"
FT                   /protein_id="ABF92036.1"
FT                   /translation="MGSKARPSWEWLLHARLGHMNSIRVWAVCLSSLFWACINVPGIEI
FT                   VPESPDAGPPSQDVTLTLSRAATNGDVDVRVSVAELAPESVELLVDGVPTATLPQPSYE
FT                   LRWSTRDLDEGQYIITARASIGDRVYVSAANTLFVDRTAPWVVTQSPRSGDRDVSVHAP
FT                   IQAVFSEAVEPSTVNAESIRLLVNQSDITAGVRLSADGMTVTLTPATQIPVDSNVSVTI
FT                   APSVTDVAGNALDVTALDWEWAIPRHLHYGGALSAGTVEASNVSKFSFVLDGNGNPVVA
FT                   FVDGDSPSEHGVYVMRWTGAAWEQLGEVLGASAAESIIMACSLQISPGGEFLVAWSVET
FT                   SDGTPSVHVRRWSGGGWSAVGAPVTATYLEARFGSFDFVVDSRGGRWLVVHEFIEGNSS
FT                   SISTWLWDGESWERVKHVLTVNHHLEMASLNLMVDSADRPALFWALHSSRGGGMELHSR
FT                   RWAETHWVESDWIPSGGGIPIASALDGADRLVLAGSSQDVVAGAGFRPIVGRFVPGGGW
FT                   QLLGPVIEGMYPGETNATAEVLELDHDGQLVALISEPEIAGGPVNHYVRRWDESSWAPM
FT                   GTPLLPRPGATPVGPAQFFMTGPEQWVLARIEESAGTPSRRHLYVYRPNN"
     ttgggcagca aagcccgccc ttcctgggaa tggctgctgc atgcccgatt aggacatatg        60
     aactccatca gggtttgggc agtgtgtctc agttccttgt tctgggcatg catcaacgtg       120
     cctggaatcg aaattgtgcc cgagtcgccg gacgcggggc cgccaagcca ggatgtgacg       180
     ctaacgctgt cgcgtgcggc gacgaatggt gatgtcgatg tgcgagtttc ggtcgcggag       240
     ttggcgccgg agtcggtcga gttgctggtt gatggcgtcc ccacagcgac gttgccccag       300
     ccttcttacg agttgcggtg gagcacccgt gacctcgacg agggccagta catcatcacc       360
     gcaagggcat caatcggcga ccgtgtttac gtgagtgcgg cgaacacgct gttcgtcgac       420
     cggacagcac cgtgggtggt gacgcagagc cctcggtctg gggaccggga cgtttccgtg       480
     catgctccca ttcaggctgt cttctccgag gctgtcgagc cgtccaccgt gaacgcggag       540
     tccatcaggc tcttggtcaa tcaatcggat attactgcag gggtgcgcct gtcggccgat       600
     ggcatgacgg tgacgctgac gcctgctacg caaattcccg tggactcaaa tgtatctgtg       660
     accatcgcgc cttcggtgac agacgtggca ggcaacgcgt tggatgtaac ggcactggat       720
     tgggagtggg ccatccccag gcatctccat tacggagggg ccctttctgc cggcactgtc       780
     gaggcttcga acgtctcgaa gttctcgttt gtgctggatg ggaatggaaa ccctgttgtt       840
     gctttcgttg atggcgattc gccttccgaa catggtgtct acgtcatgcg gtggaccggc       900
     gcggcatggg agcagttggg tgaggtgctt ggagcgagcg ctgccgaatc catcattatg       960
     gcttgctccc ttcagatatc accgggaggc gagttcctcg ttgcatggag tgtggagacg      1020
     tccgacggta cgccaagcgt acacgtccgg cgctggagcg gaggcggttg gtcagccgtt      1080
     ggtgcgcctg ttacagcaac ttatcttgaa gcgaggttcg gttcattcga ttttgtagtg      1140
     gactctcgcg gagggcgttg gctggttgtt cacgagttca tcgaagggaa ctcttcttcc      1200
     atttcgactt ggctctggga tggagaatct tgggagaggg tgaagcatgt tctgacggtg      1260
     aatcatcatc tggagatggc tagtctgaac ttgatggtgg attcggctga tcgtcctgct      1320
     cttttttggg cccttcattc cagcagaggg gggggaatgg agctgcattc caggagatgg      1380
     gccgagacac attgggtgga gtccgactgg ataccatcgg gaggcgggat tccgattgcg      1440
     tccgcattgg atggagcgga tcggctcgta cttgctggct catcacaaga tgtagtggca      1500
     ggcgcgggct tcagacccat cgtcggacgt tttgtcccgg gaggaggatg gcagctcctc      1560
     ggccctgtta tcgaaggcat gtaccccggc gaaaccaacg ctacggcgga ggtccttgag      1620
     ctcgaccatg atggccagtt ggtcgcgctc atctccgaac ctgagatcgc cggtggcccg      1680
     gtgaaccact acgttcgccg ctgggacgaa agttcatggg cgcccatggg gactccgctg      1740
     ctcccgcgcc caggcgctac gccggtgggc cccgcccagt tcttcatgac gggccccgag      1800
     caatgggtgc tggcccgcat cgaggagtcc gcaggcaccc ccagccgtcg ccacctctac      1860
     gtctaccgtc ccaacaactg a                                                1881
//

If you have problems or comments...

PBIL Back to PBIL home page