(data stored in ACNUC30630 zone)

EMBL: CP000113.PE509

CP000113.PE509       Location/Qualifiers
FT   CDS_pept        594757..595827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0526"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92486"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX8"
FT                   /protein_id="ABF92486.1"
FT                   /translation="MMRSGRSKCLRVPRRVAGRAAAADIDSVVGPGRWWVMGAWKQTVA
FT                   ALVSAVSMVGCAGNVMEAEPVALRSGVAELVAPNGRNLNGRNLNGRNLNTPELGQLLVS
FT                   VDLAGARIAEEVLGEVRLEGSVFHGVASSGPVSGQSFLGARFIGNLSSGDTVELRVDGI
FT                   EPGAGADADVWAYLVSYYDAADALWKPACAAADGSALSAIPVAGRWDYRQGVAGGGAKV
FT                   DDAARFTFACEGAAIAKCVRFGYRPWGTTADGLSLADHHQACTRMVRADFCGDGTSHTT
FT                   DGQWVNLHDGVNVQTDTEAWLHEAEWDADGARCFTQTTRAAQAVSCPGQTQLTQCGKWA
FT                   HFQAGTLIMSEVPPAQ"
     gtgatgcgca gtggacgaag caagtgcctg cgggtcccca ggcgagttgc tgggcgggcg        60
     gccgctgcgg acattgattc cgtggtcggg ccgggaaggt ggtgggtgat gggtgcttgg       120
     aagcagacgg tggcggcgct ggtcagcgcg gtgagcatgg tgggctgtgc ggggaacgtg       180
     atggaggcgg agccggtggc gcttcgctcg ggcgtggcgg agctggtggc gccgaacgga       240
     cggaacctga atggccgcaa cctgaatggc cgcaacctga acacccccga gctgggacag       300
     ctgctcgtgt ccgtggacct ggcgggcgcc cgcatcgcgg aggaggttct cggcgaggtg       360
     cggctggagg gcagcgtctt ccacggcgtc gcctccagcg gcccggtgtc cggccagtcc       420
     ttcctgggcg cgcgcttcat cggcaacctg agcagtggtg acaccgtgga gctgcgcgtt       480
     gacggcatcg agcctggagc gggcgcggac gcggacgtct gggcgtacct cgtctcctac       540
     tacgacgcgg cggatgccct ctggaagccc gcgtgcgcgg cggcggacgg ctccgcgctg       600
     agcgccattc ccgtggcggg ccggtgggac taccgccagg gcgtggcggg cggcggcgcg       660
     aaggtggatg acgccgcgcg cttcaccttc gcctgtgagg gggcggccat cgccaaatgc       720
     gtgcgcttcg gctaccggcc ttggggcacc acggcggacg gcttgagtct ggcggaccac       780
     caccaggcgt gcacgcgcat ggtgcgcgcg gacttctgcg gcgacggcac gtcgcacacc       840
     acggatggcc agtgggtgaa ccttcatgac ggcgtgaacg tgcagacgga tacggaggcg       900
     tggctacacg aagccgagtg ggacgccgac ggtgcgcgct gcttcacgca gacgacgcgc       960
     gcggcacagg ccgtgagctg cccggggcag acgcagctca cccaatgcgg caagtgggcc      1020
     cacttccagg ccggcacgct catcatgagc gaggtccctc ccgcgcagta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page