(data stored in ACNUC30630 zone)

EMBL: CP000113.PE51

CP000113.PE51        Location/Qualifiers
FT   CDS_pept        complement(60556..60996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91155"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG86"
FT                   /protein_id="ABF91155.1"
FT                   /translation="MPRQSPRWCLAAAVAVLLAGTAASSQSSSSITFQSPAQGWNVFAS
FT                   SNPLPFGSTAAIHYSVDRLTQCRGNINGTTPGWTMTGYYQFNDGPVQRFWVAGFSSTPN
FT                   PPAPSIPLNTRGTLAIWFENTSRWGCQAWDSNFGNNHVFTVQ"
     ttgccgcgtc aatccccccg ctggtgtctc gccgccgccg tcgccgtgct gctcgccgga        60
     acggccgctt cctcgcagtc ctcctccagc atcaccttcc agtcgccggc gcagggctgg       120
     aacgtgttcg cgtcctccaa cccgctgccc ttcggctcca ccgcggccat ccactacagc       180
     gtggaccggc tgacgcagtg tcggggcaac atcaacggca ccacgcccgg gtggacgatg       240
     acgggctact accagttcaa cgacgggccg gtgcagcgct tctgggtagc gggcttctca       300
     tccacgccca acccgcccgc gccgtccatc ccactcaaca cgcggggcac gctggccatc       360
     tggttcgaga acaccagccg ctggggctgc caggcctggg attcgaactt cggcaacaac       420
     cacgtcttca ccgtgcagtg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page