(data stored in ACNUC30630 zone)

EMBL: CP000113.PE511

CP000113.PE511       Location/Qualifiers
FT   CDS_pept        597272..600463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0528"
FT                   /product="efflux transporter, AcrB/AcrD/AcrF family, inner
FT                   membrane component"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86313"
FT                   /db_xref="GOA:Q1DEX6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEX6"
FT                   /protein_id="ABF86313.1"
FT                   /translation="MFISYFAIKRPIITINSMLALVVFGLVSLGLLETDEFPDVQPPVV
FT                   SVTIVYPGASPETVEREILEPIEDAIFAISGVDPKETTSIATDGLASFTVFFDFEKDIQ
FT                   EATQDIRDAISSKRADLPQEMEEPILTRFDPADQPIVSLTLTSEGLDVAALSLVADPTV
FT                   VGELRSVPGVAQAEVVGDVAREMTVQLKPEALQAAGLSVAEVVAALQAQNLAAPVGRIN
FT                   APLTEESIRLKGRLEKVEDFRTMVVASRNGRAIRLEQVADVFVGAEEPRTLALFNGAQA
FT                   VGIDVLKARGYSTTEVADAVRERVHALQQRLPAGVKLEIVRDAGVRVENAVHNVQSALV
FT                   EGALLTVLVVFVFLNSWRSTVITGLALPVSVLASFISVWAFGFTLNTMSLLGLTLAIGI
FT                   LIDDAIVVRENIVRHVEMGKDHYTASREGTSEIGLAVSATTFSIVAVFVPVAFMYGVAG
FT                   QWFKPFALTIACAVLVSLFVSFSLDPMLSAYWPEPPRKQNPGFITRTLNRFNAWFDRQA
FT                   ERYKHVIAWALDHRLVMVLVAVGSLVGALVLQGTVGGAGFVPVSDRAEVELLVETPPGS
FT                   SLEYTRRKVDEVTRTLRAHPEVDYTYATIGVPLALSAPGVDQALVYVRLKPKAERDMSQ
FT                   DALGVQFREEMKRIGGATVSVFTSGFGGAFKQLQYELRGPDQRVLTQLAQQVQKEVEQV
FT                   AGAVDVGLSTRGQKPELEVELNRGLAGQLGVTVGQVAQVLRPAFAGLDVGDWVDPIGET
FT                   RDVMVRLAPGARDNPNDLSQLPISVGAASGPPRLVPLGQVADIRQTLGPAQVTHLNRER
FT                   VINVQANVQGRSLSEVGADIEKRLDGVKLPPGYMLTTGGESADQAEVFMRVFIALGMAL
FT                   MLMYLILVIQFGSFLDPLAILISLPLSLIGVVLALLITGDTLNLMSLIGIMLLMGIVAK
FT                   NAILLIDFAKWSHEKGMPLREALIEAGRIRLRPIIMTTFALVAGMVPVAIGAGEGGDFR
FT                   APLGRAVIGGTLTSTLLTLLVIPTVYEILVDGRTWSTRMLRKLFRMKPPEQRPHVPGGG
FT                   GGRGEPRPAPQARHD"
     gtgttcatct catacttcgc catcaagcgg cccatcatca ccatcaattc gatgctggcg        60
     ctggtggtct ttggccttgt gtcgctggga ctcctggaga ccgacgagtt ccccgacgtc       120
     cagcccccgg tggtgagcgt caccatcgtc tatccaggcg cttcacccga gacggtggag       180
     cgggaaatcc tcgagcccat cgaggacgcc atcttcgcca tcagcggcgt ggacccgaag       240
     gagacgacgt ccatcgccac cgacggcctg gcgtccttca cggtgttctt cgacttcgag       300
     aaggacatcc aggaagcgac gcaagacatc cgggacgcca tctccagcaa gcgcgcggac       360
     ctgccacagg agatggagga gcccatcctc acgcgcttcg acccggcgga ccagcccatc       420
     gtgtcgctaa cgctcacctc ggaaggactg gacgtcgcgg cgctgtcgct ggtggcggac       480
     ccgacggtgg tgggcgagct gcgctcggtg cccggcgtcg cccaggcgga agtcgtcggt       540
     gacgtggcgc gggagatgac ggtgcagctc aagccggagg cgctccaggc cgcgggcttg       600
     tcggtggcgg aggtggtggc ggcgctccag gcgcagaacc tggcggcgcc ggtgggccgc       660
     atcaacgcgc cgctgacgga ggagtccatc cgcctcaagg gccgactgga gaaggtggag       720
     gacttccgga ccatggtggt ggcctcgcgc aacggtcggg ccatccgcct ggagcaggtg       780
     gcggatgtct tcgtcggcgc cgaggagccg cgcacactgg cactcttcaa cggcgcccag       840
     gcggtgggca tcgacgtgct caaggcccgt ggctacagca ccaccgaggt cgcggacgcg       900
     gtgcgtgagc gggtgcacgc gctccagcag cggctccccg cgggcgtgaa gctcgaaatc       960
     gtgcgcgacg ccggcgtccg cgtggagaac gccgtgcaca acgtgcagtc cgcgctggtg      1020
     gaaggcgcgc tgctcacggt gctggtcgtc ttcgtctttc tcaactcgtg gcgctccacc      1080
     gtcatcaccg gcctggcgtt gccggtgagc gtgctggcgt ccttcatcag cgtgtgggcc      1140
     ttcggcttca cgctcaacac catgtcgctc ttgggcctga cgctggccat cggcattctc      1200
     atcgacgacg ccatcgtcgt gcgagagaac atcgtccgcc acgtggagat ggggaaggac      1260
     cactacacgg cgtcgcgcga gggcacctcg gaaatcggtc tcgcggtttc ggcgaccacc      1320
     ttctccatcg tcgccgtatt cgtgcctgtg gccttcatgt acggcgtggc cggccagtgg      1380
     ttcaagccct tcgccctcac catcgcctgc gcggtgctgg tgtcgctgtt cgtgtccttc      1440
     tcgctggacc cgatgctgag cgcgtactgg ccggagccgc ccaggaagca gaacccgggc      1500
     ttcatcaccc ggacgctgaa tcgcttcaac gcctggttcg accggcaggc ggagcgctac      1560
     aagcacgtca tcgcctgggc gctggaccac cggctggtga tggtgctggt ggcggtgggc      1620
     tcgctggtgg gcgcgctggt gctccagggc accgtgggcg gcgccggctt cgtgccggtg      1680
     agcgaccgcg cggaggtgga gctgttggtg gagacgcccc caggctccag cctggagtac      1740
     acgcggcgca aggtggacga ggtgacgcgt accctgcgcg cccacccgga ggtggactac      1800
     acctacgcga ccatcggcgt gcccctggcg ctcagcgcgc ccggcgtgga ccaggccctg      1860
     gtgtacgtgc ggctcaagcc gaaggcggag cgcgacatga gccaggacgc attgggcgtc      1920
     cagttccgcg aggagatgaa gcgcatcggc ggtgccaccg tctccgtctt cacctcgggc      1980
     ttcggtgggg ccttcaagca gctccagtac gagctgcgcg gtccggacca gcgggtgctc      2040
     acgcagctag cgcagcaggt ccagaaggaa gtggagcagg tagccggcgc ggtggacgtg      2100
     ggcctgtcca cgcgagggca gaagccggag ctggaggtgg agctaaaccg cgggctcgcc      2160
     ggacagttgg gcgtgacggt ggggcaggtg gcccaggtgc tgcggccggc cttcgcgggc      2220
     ctggacgtgg gggactgggt ggaccccatc ggggagacgc gagacgtcat ggtgcggctg      2280
     gctccgggtg cgcgtgacaa ccccaatgac ttgtcgcagt tgcccatctc cgtaggcgcg      2340
     gcgagcgggc cgccccggct ggtgccgctg gggcaggtgg cggacatccg tcaaacgttg      2400
     ggtccggcgc aggtaacgca cttgaaccgt gagcgcgtca tcaacgtcca ggcgaacgtg      2460
     caggggcgct cgttgtcgga ggtgggcgcg gacatcgaga agcggctgga cggcgtgaag      2520
     ctgccgccgg gctacatgct gacgacgggc ggcgagtccg cggaccaggc cgaggtgttc      2580
     atgcgcgtgt tcatcgcgct cggcatggcg ctgatgctga tgtacctcat cctggtcatc      2640
     cagttcggct ccttcctgga cccgctggcc atcctcatct cgctgccgct gtcgctcatc      2700
     ggcgtggtgc tggcgctgct catcaccggt gacacgctca acctcatgag cctcatcggc      2760
     atcatgctgc tgatgggaat cgtcgcgaag aacgccatcc tcctcatcga cttcgccaag      2820
     tggtcgcacg agaagggcat gcctctgcgc gaggcgctca tcgaagcggg ccgcatccgt      2880
     ctgcgcccca tcatcatgac gaccttcgcg ctggtggcgg gcatggtgcc ggtggccatc      2940
     ggcgcgggtg agggcggcga cttccgcgcg ccgctgggac gcgcggtgat tggcggcacg      3000
     ctgacgtcca cgctgctgac actgctggtg attcccacgg tgtacgaaat cctggtggac      3060
     ggccggacat ggtccacgcg catgctgcgc aagctcttcc ggatgaagcc tcccgaacag      3120
     cggcctcacg ttccgggcgg aggcggcggc cgtggagagc cccggcccgc ccctcaggcg      3180
     cggcacgatt ga                                                          3192
//

If you have problems or comments...

PBIL Back to PBIL home page