(data stored in ACNUC30630 zone)

EMBL: CP000113.PE522

CP000113.PE522       Location/Qualifiers
FT   CDS_pept        complement(619505..619969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88704"
FT                   /db_xref="InterPro:IPR035223"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW5"
FT                   /protein_id="ABF88704.1"
FT                   /translation="MPGKQARSTPRTHKPYGFAEQRNPEGKHMHHTREIPREGWGDYLA
FT                   LLSNLERDHWVRIETESVDFGDQPLAGRLPLVEIALESKGSDQGSVEIIVGRPGGEVTH
FT                   RILKPDHIYADESESGELECLDIEDADQVKTLIFFEPQRAGDELGIGAPS"
     gtgccaggga agcaggcccg ttccacaccc cgcacgcaca agccttacgg ttttgctgag        60
     caacggaatc cggagggcaa acacatgcat cacactcggg agatacccag ggaaggctgg       120
     ggggactacc tcgccttgct gagcaacctg gagcgcgacc actgggtgcg catcgagacg       180
     gagagcgtcg acttcggcga ccagccgctc gccggcaggc tgccgctggt ggagattgcc       240
     ctcgagtcga aggggagcga ccagggctcc gtggaaatca tcgtgggccg gccgggcgga       300
     gaggtcaccc accgcatcct caagcccgac cacatctacg cggacgagag cgagagcggc       360
     gagctggagt gcctggacat cgaggacgcg gaccaggtga agacgctcat cttcttcgag       420
     ccgcaacgcg cgggcgacga gctgggcatc ggcgcgccgt cctga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page