(data stored in ACNUC30630 zone)

EMBL: CP000113.PE523

CP000113.PE523       Location/Qualifiers
FT   CDS_pept        complement(619994..621154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0540"
FT                   /product="ATP-binding protein, ClpX family"
FT                   /note="identified by match to protein family HMM PF07724"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87913"
FT                   /db_xref="GOA:Q1DEW4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEW4"
FT                   /protein_id="ABF87913.1"
FT                   /translation="MESPGMSITHPGLEPLPESPDEDVRARVAAIEVLSPREIDERLSD
FT                   LGYRGQTEARRAASVLAYRHLRRIRHLFLEGLAPEPGMRENCLFLGPTGSGKTFLVELL
FT                   FREILAVPTVLADATQFSETGYVGDDVSTLLSRLYEAADRNAAWAGCGVVCMDEFDKLA
FT                   TSRSDSRFAGQQTTKDVSGFGVQRSLLHMLSAPSADFPPDFGFTSRQRPDTMELACVTF
FT                   IACGAFSGLSATAEGLARSEHLGFGREPLPARVESIATRVTEEQLEQTTAFARYGFIPE
FT                   LIGRFNRLVSFSPLDAGTLDDILQHNVLRAYEREFEQEGLRLQVDTEVREFVVARALKR
FT                   ETGARGLRTTLAPLLERAAYEHFGHRDNDGTLRLTLEAGEVQARRV"
     ttggagtccc ctggaatgag catcacccac cctggcctgg agccgctgcc cgaatcgcct        60
     gacgaggacg tgcgcgcgcg cgtcgccgcc atcgaggtcc tctctccccg cgaaatcgac       120
     gagcggttgt cggacctcgg ctaccggggg cagacggagg cgcgccgcgc ggcatccgtg       180
     ctggcgtacc ggcacctgcg ccgcatccgt cacctgttcc tggaggggct cgcccccgaa       240
     ccgggcatgc gggagaactg cctcttcctg gggcccaccg gctcagggaa gacgttcctc       300
     gtggagctgc tgttccgcga aatcctcgcc gttcccaccg tgctggcgga cgccacgcag       360
     ttctccgaaa cgggctacgt gggcgacgac gtgagcacgc tgctgtcgcg cctgtacgaa       420
     gccgcggacc ggaacgcggc ctgggccggc tgcggcgtgg tgtgcatgga cgagttcgac       480
     aagctcgcca ccagccgctc cgacagccgc ttcgccggcc agcagaccac gaaggacgtc       540
     agcggcttcg gcgtgcagcg cagcctgctg cacatgctgt ccgcccccag cgcggacttc       600
     ccgcccgact tcggcttcac cagccgccag cggcccgaca ccatggagct ggcctgcgtc       660
     accttcatcg cgtgcggcgc cttcagtggc ctgagcgcca ccgcggaggg gctggcccgg       720
     agcgaacacc tgggcttcgg ccgcgaaccg ctcccggcgc gggtggagag catcgccacg       780
     cgagtgacgg aggagcagtt ggaacagacc accgccttcg cgcgctacgg cttcatcccg       840
     gagctcattg gccgcttcaa ccggctggtc tccttttcgc ccctggacgc gggcaccctg       900
     gacgacatcc ttcaacacaa cgtgctgcgt gcctacgagc gcgagttcga gcaggaaggg       960
     ctgcgcctgc aggtggacac cgaggtgcgg gagttcgtgg tggcccgcgc gctcaagcgg      1020
     gagacgggcg cacgagggct gcgcaccacg ctcgccccct tgctggagcg ggccgcctac      1080
     gagcactttg gccaccgaga caacgacggc acgctccggc tgacgctgga ggccggcgag      1140
     gtccaggcgc ggcgggtgta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page