(data stored in ACNUC30630 zone)

EMBL: CP000113.PE528

CP000113.PE528       Location/Qualifiers
FT   CDS_pept        complement(628544..628726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89480"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV9"
FT                   /protein_id="ABF89480.1"
FT                   /translation="MLELSDPNVWRIPMVKAKTKTKASKQTKKLTQALRELNKTTKPAG
FT                   SANVFNTCSRFMYCV"
     atgcttgagc tgtctgaccc caacgtgtgg aggattccca tggtgaaggc gaagacgaag        60
     acgaaggcgt ccaagcagac caagaagctg acccaggcgc ttcgggagct gaacaagacg       120
     acgaagcccg cgggttccgc caacgtgttc aatacctgct cgcgcttcat gtactgcgtc       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page