(data stored in ACNUC30630 zone)

EMBL: CP000113.PE533

CP000113.PE533       Location/Qualifiers
FT   CDS_pept        complement(632639..633613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89356"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEV4"
FT                   /protein_id="ABF89356.1"
FT                   /translation="MKRLCLLLTLPLFPLLSTDAHAASTDTHPALRASTCSVRGLMDDI
FT                   RRGLGSGSPSYQRYLRTLLREAAVTLPDAELRDAFARETDPVMAEHLAAALVARAEREA
FT                   DTQAMDVVAQRALHDADPSVRAATLRAMRRTSALERTGDLYERMVRDESPQVRQEAATN
FT                   LIEDNAHVYAGQYGPAADTAVTAAVASTDPAVTARILDNLSTEKISAESADRITSLLRS
FT                   DDASVRKAAVNALGGVPAEQMQGARESLLAMYREETDEGVRKALLQSVAQLGFEGAIPD
FT                   LQRMRAMDPRLAQEADAWIQVLGMGLQEWSLLLREKQRLQQAP"
     atgaaacgcc tctgccttct gctcacgctg cccctcttcc ccctactgtc caccgacgcg        60
     cacgcggcct ccaccgacac tcatcccgcg ctccgggcca gcacctgctc cgtgcgcggg       120
     ttgatggatg acatccgccg cggactgggc tccggctcac cgtcctacca gcgctacctg       180
     cgcaccctgc tgcgcgaggc cgccgtcacg ctgccggacg cggagctgcg cgacgccttc       240
     gcgcgggaga cagaccccgt catggccgaa cacctggcgg cggcgctggt ggcccgcgcg       300
     gaacgtgaag cggacaccca ggccatggac gtggtggcac agcgcgcgtt gcacgacgcg       360
     gacccgtccg tgcgcgccgc cacgctgcgg gccatgcggc gcaccagcgc gctggagcgc       420
     accggtgatt tgtacgagcg catggtgcgg gacgagtcgc cccaggtgcg gcaggaggcg       480
     gcgaccaacc tcatcgagga caacgcacac gtgtacgccg gccagtacgg cccggcggcg       540
     gacacggcgg tgacagccgc ggtggcctcc acggacccgg cggtgacggc gcgcatcctg       600
     gacaacctct ccactgagaa aatcagcgcc gagtccgcgg accgcatcac gtccctgctg       660
     cgcagcgatg acgcgagcgt gcgcaaggcc gccgtcaacg cgctgggcgg cgtcccggcg       720
     gagcagatgc agggcgcccg cgagtccctg ctcgccatgt accgcgagga gacggacgag       780
     ggcgtgcgca aggcgctgct ccagagcgtc gcgcagctcg gcttcgaggg cgcgattccc       840
     gacctccaac gcatgcgcgc catggacccg cgcctggcgc aggaggccga cgcgtggatt       900
     caggttctcg gcatgggcct tcaggagtgg agcctgctcc tgagggagaa gcagcggttg       960
     cagcaggctc cgtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page