(data stored in ACNUC30630 zone)

EMBL: CP000113.PE545

CP000113.PE545       Location/Qualifiers
FT   CDS_pept        646394..647767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0562"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="identified by match to protein family HMM PF07396"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90247"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEU2"
FT                   /protein_id="ABF90247.1"
FT                   /translation="MRAFARCWQFRAVMTPTASFRAALQVLLSGSALLLAPLAHAQQDD
FT                   AAPSSATEPPPASEPTPTPVPEAAMPEPETKPQAKKEERAWYDRIRIRGYTQFRYNRLP
FT                   SFRVNDELVNDQGDRFLGKNTGFGIRRARLVLFGDVHDRVSIYLQPDFASVIGDQYNVT
FT                   IMRDWYADIFLDAKKEFRLRVGQSKVPYGFENLQSSQNRLALDRNDAINSGLKDERDLG
FT                   VFFYWAPDEIRKRFKFLVDNNLKGSGDYGVVGLGVFNGQTANRAERNDTPHGVVRVTWP
FT                   FLFGSQYVEAGVGGYYGRFNLNASPRDGAPYALARGSDMVDARAIVSLVIYPQPLGLLA
FT                   EFNLGRGPSLGEGPVEGLLIDSRRLRGGYAQLMYKLDGVLGVSLIPYIRGTLYDGGKKF
FT                   ETNAPLYDVRELEMGAEWQLNKALELTGTYLISDRTSSRYPYIQEQGHVTRIQLQVNY"
     gtgcgcgctt tcgcgcgctg ctggcagttc cgcgccgtca tgacccccac tgcttcgttc        60
     cgcgctgctc tccaggtcct gttgtccggc tccgcgctgc ttctggcgcc ccttgcccac       120
     gcgcagcagg acgatgccgc gccctcgtcc gccaccgagc cgcctcccgc gtcagagccc       180
     acgccgacgc cggttcccga ggcggcgatg cccgagccgg agacgaagcc ccaggccaag       240
     aaggaggagc gggcctggta cgaccgcatc cgcattcggg gctacacgca gttccgctac       300
     aaccggctgc ccagcttccg ggtgaatgac gaactggtca acgaccaggg cgaccgcttc       360
     ctcggcaaga acaccggctt tggcatccgg cgcgcgcgcc tcgtgctgtt cggtgacgtc       420
     cacgaccgcg tgtccatcta cctccagccg gacttcgcgt cggtcatcgg ggaccagtac       480
     aacgtcacca tcatgcggga ctggtacgcg gacatcttcc tggacgcgaa gaaggagttc       540
     cgtctgcgcg tgggccagtc gaaggtgccg tacggcttcg agaacctcca gtccagtcag       600
     aaccgcctcg cgctggaccg caacgacgcc atcaacagcg ggctcaagga cgagcgcgac       660
     ctgggcgtct tcttctactg ggcgcccgac gaaatccgga agcgcttcaa gttcctcgtg       720
     gacaacaacc tgaagggctc tggcgactac ggcgtggtcg gcctcggcgt cttcaacggc       780
     cagacggcca accgcgccga gcgcaatgac acgccgcatg gtgtcgttcg cgtcacgtgg       840
     cccttcctgt tcggctcgca gtacgtggaa gcgggcgtgg gcggctacta cggccgcttc       900
     aacctcaatg cctcgccgcg tgacggcgcg ccctacgcgc tcgcccgggg ctccgacatg       960
     gtggacgcac gcgccatcgt cagcctggtt atctatccgc agccgctggg gctcctggcc      1020
     gagttcaacc tgggccgcgg tccctcgctg ggcgaggggc ccgtcgaggg cctgctcatc      1080
     gacagccgcc ggctccgggg tggttatgcg cagctcatgt acaagctgga cggcgtgctg      1140
     ggcgtgtccc tcatccccta catccggggc accctctacg acggcggcaa gaagttcgag      1200
     acgaacgcgc cgctctacga cgtgcgggag ctggagatgg gggccgagtg gcagctcaac      1260
     aaggccttgg agctgacggg cacctacctc atctcggacc gcacctcgtc ccgctatccg      1320
     tacatccagg agcagggaca cgtgacgcgc atccagctcc aggtcaacta ttga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page