(data stored in ACNUC30630 zone)

EMBL: CP000113.PE551

CP000113.PE551       Location/Qualifiers
FT   CDS_pept        652654..654777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89207"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET6"
FT                   /protein_id="ABF89207.1"
FT                   /translation="MVQDVHKARCVRRVLWVGWCLGWWLAGALPVHAAPYEVEPESVGA
FT                   QDLLALVEEGAISAETLSALLALRRTGVDLGLASRASLYGLPGLTYSDVDVLLRSRGEG
FT                   SAAGGALTEAASRRLAPFLDVRTPGRLSGDARLMMAFAASDGLPPPLALQVRAGGLAGL
FT                   RAGLMTTLARRTLAPPRRDARRRAFVVEAPGTSVTLPKLYVQWTGARASLLAGTYRLGF
FT                   GQRLTLDTTALPSPDGFLPDDDVRPPAGLERSCLVGSAGCEPEERLSDVTPDFRWDEGF
FT                   RGVAGTVRGPLGTWAALSLTGFGSYQSRALARHAVLDRSLCPSSARGACKAPDVWVSVA
FT                   EGRWEKLTARTLSGMFRELAGGGNATLAMSSRSHVGLTGWMARPMWGQEGAKLDFQPNA
FT                   RYPAGGAFGAFGLDAAWGRGALDVFLEGTRSFDAAPGGGGDFGAVQRTVLSGGARELEL
FT                   SLRYYGRGFANPYSGAPSGPDALEGLRVRNELGARLRYLHREEGAWRLRGQVDAWTLPA
FT                   DGAVSGSAGTLHARASVRGDLRVRPWLQPSLQVELRDNGVGGMGACADDSLSAQDVADL
FT                   CASARYGVTARVRSDVAKGLTVSLQYGHARVQAPETKGLRYDAQAVLDVRAQPLSSLKL
FT                   HGRLVWKDQDLSERSRLQQELRTALDVAWRVSSAVSARGRYAWVLDLKDARVARVPPDP
FT                   PRHLFHLELETRF"
     gtggtccagg atgtgcacaa ggcgcggtgc gtgcgtcggg tgctctgggt gggatggtgt        60
     ttgggttggt ggctggcggg ggcgctgccc gtgcatgccg cgccgtatga agtggagccc       120
     gagtccgtgg gcgcgcagga cctgctcgcg ctcgtggaag agggtgccat ctccgccgag       180
     acactctccg cactgctggc cttgcggcgg actggcgtgg acctggggct ggcgtcccgt       240
     gcctcgctct acggcttgcc ggggctgact tactcggacg tggacgtgct gctgcggtcg       300
     cgcggagaag gcagcgccgc gggtggcgcg ttgacggagg cggcgtcgcg gcggctcgcg       360
     ccgttcctgg acgtgcggac gccggggcgg ttgtcgggtg atgcacggtt gatgatggcc       420
     ttcgcggcgt cggatgggct gccgccgccg ctggcattgc aggtccgcgc tggagggctc       480
     gcggggcttc gagcggggct gatgacgacg ctggcccggc ggacgctggc gcctccgcgc       540
     agggacgcgc ggcgacgtgc cttcgtggtg gaggcacccg ggacatccgt cacgctgccc       600
     aagctgtacg tgcagtggac gggagcgcgc gcgtcgctgc tggcggggac gtatcggctg       660
     ggcttcgggc aacggctcac actggacacc acggcgctgc cgtcacccga cgggttcctt       720
     cctgatgatg acgtgcgtcc tccggcggga ttggagcgct cgtgtctggt gggcagtgcg       780
     ggttgtgagc ccgaggaacg cctgtcggac gtcaccccgg acttccgctg ggacgagggc       840
     ttccggggcg tcgctggcac ggtgcgaggc ccgctgggga cgtgggccgc gctgtcgctc       900
     accggcttcg gctcgtatca gtcccgtgcg ctggcacggc atgcggtgct ggaccgctcg       960
     ctgtgtccgt cgtccgcccg tggcgcgtgc aaggcccctg acgtctgggt gtccgtggcg      1020
     gagggccggt gggagaagct gacggcgcgg acgctgtcgg ggatgttccg agagctggcg      1080
     ggcggtggca acgcgacgct ggcgatgtcg tcgcggagcc atgtggggct caccggttgg      1140
     atggctcgac ctatgtgggg gcaggagggg gcgaagctcg acttccagcc caatgcccgc      1200
     tacccggcgg gcggtgcctt tggcgcattc gggctcgacg ccgcgtgggg gcgtggcgcg      1260
     ctggacgtct tcttggaagg cacgcgcagc ttcgatgccg cgccgggtgg cggcggggac      1320
     ttcggtgcgg tgcagcgcac cgtgctgtca gggggggcgc gcgagctgga gctgtcgctg      1380
     cgctactacg ggcgcggttt cgccaatccc tacagcggcg cgccgtcagg cccggatgcg      1440
     ctggaaggcc tgcgcgttcg caacgagctg ggcgcccggc tgcgctacct ccaccgtgag      1500
     gaaggcgcat ggcggctgcg agggcaggtg gacgcctgga cgctgcccgc ggatggggcg      1560
     gtgtctggga gcgcgggcac gctgcacgcg cgtgcctcgg tgcgcgggga ccttcgggtg      1620
     cggccctggt tgcagccctc gctccaggtg gagttgcgtg acaacggcgt gggcgggatg      1680
     ggggcgtgcg cggatgactc gctctccgcg caagatgtgg cggacctgtg cgccagcgcg      1740
     cggtacggcg tcaccgcccg ggtgcgctcc gacgtcgcga aggggctgac ggtttcgctc      1800
     cagtacggac acgcgcgcgt gcaggccccc gagacgaagg gacttcgcta cgacgcgcag      1860
     gccgtgctgg atgtccgcgc ccagccgctc tcgtcgctga agttgcatgg gcgattggtg      1920
     tggaaggacc aggacctctc cgagcgcagc cggctccaac aggagctgcg gaccgcgctg      1980
     gatgtcgcgt ggagggtgtc gagcgccgtg tccgcccggg gccggtacgc gtgggtgctc      2040
     gacttgaagg acgcgcgcgt ggcgcgtgtg cctcccgacc cgccgcgcca cctcttccac      2100
     ctggagttgg agacgcgctt ttga                                             2124
//

If you have problems or comments...

PBIL Back to PBIL home page