(data stored in ACNUC30630 zone)

EMBL: CP000113.PE555

CP000113.PE555       Location/Qualifiers
FT   CDS_pept        659640..660470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0572"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92333"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DET2"
FT                   /protein_id="ABF92333.1"
FT                   /translation="MKKVLIGLGIGCGVFILAGIGLMLAGGIWAKNKFGGSIEAMQSIQ
FT                   AQEQELTQLNASNPFKAPPEGQVLPLDEPRLLAYLTVRESALPAFKAFEAKSKEFEAQH
FT                   AGDGDEKPGFNAAVDAASLFMGLMADVRKAYIAGLKAQGMSPAEFQSITTTVYASMVAD
FT                   SLEQIGAAAEQGRKMMVTQLAEVDKRLADDSLADEERAQLEEARAQLQDTLDAIEEPGA
FT                   NEEQPLSEASKKAAAANVELLKKHKERVELMANVAFDGFVLGGAGADGQAAGLE"
     atgaagaagg tcctcatcgg actgggcatc ggctgcggtg tcttcatcct ggcgggcatc        60
     ggcttgatgc tggcgggtgg catctgggcc aagaacaagt tcggcggcag catcgaagcc       120
     atgcagtcga tacaggccca ggagcaggag ctgacacagc tcaacgccag caatccattc       180
     aaggcgcccc cggaggggca ggtgctgccg ttggacgagc cgcggctgct ggcctacctg       240
     acggtgcgcg agtcggcgct gccggccttc aaggccttcg aggcgaagtc caaggagttc       300
     gaggcccagc acgcgggcga cggtgacgag aagccgggct tcaacgcggc cgtggacgcc       360
     gcgagcctgt tcatggggct gatggcggac gtgcgcaagg cgtacatcgc cggcctcaag       420
     gcgcagggga tgtcgcccgc cgagttccag agcatcacca ccaccgtcta cgcctccatg       480
     gtggccgaca gcctggagca gattggcgcc gcggcggagc aggggcggaa gatgatggtg       540
     acgcagctgg ccgaggtcga caagcggctg gcggacgact cgctcgccga cgaggagcgc       600
     gcgcagttgg aggaggcccg ggcgcagctc caggatacgc tggacgcgat tgaggagccc       660
     ggcgcgaacg aggagcagcc gctgtccgag gcatccaaga aggcggccgc cgccaacgtg       720
     gagctgctga agaagcacaa ggagcgcgtg gagctgatgg ccaacgtggc cttcgacggc       780
     ttcgtgctgg gtggtgccgg cgccgacggt caggccgcgg gcctggagta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page