(data stored in ACNUC30630 zone)

EMBL: CP000113.PE57

CP000113.PE57        Location/Qualifiers
FT   CDS_pept        68306..70582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0060"
FT                   /product="sensory box histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF01590; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91721"
FT                   /db_xref="GOA:Q1DG80"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG80"
FT                   /protein_id="ABF91721.1"
FT                   /translation="MARPWTFAQRAGAGFIISLVVALVLAGTSVVALLSVRANHKARIL
FT                   ELSRDVLDIKQLERTFNDKVVSGRGFALSGDTFFAQDMSVARERFIATYEALKRRLTQE
FT                   PLATQLEAVSHAELEHEEAMQALIMEREDGVPRQRLEQIFDGHVADTRRRVMDSLRMLH
FT                   QQTETRLSEGIHESLATDRSALGLSLLAGSLGLAGATMLAWTLTRKLRPIQQEAEASAE
FT                   RFQLLVEGVRDYALFLLDARGRVESWNPGAERIMGYREAEILGQPSSVFYPPDAVAAGI
FT                   PDKDLVRARKDGRLHTEGWRVRKDGSRYLADVNVTVLQDARGLPRGFAKVTRDITERRR
FT                   AERTQQLLAEAGGLFHQFQDPDQTVAELTRIMVPEVADACLLYLLSASGDLWPRAVAHA
FT                   MPEKEAWLWDAARRFPPPPESPWGIWQVMRTGRSELKSDVSPETLARGLVGPEHLSLME
FT                   KVGVRSYLGVPLRVGRQTRGVFVLLTSAPERRLTVTDQVFVEEVAGRAALALDNARLWS
FT                   EAQDAVELIGVAAHDLGNPLNTLQLLLRRLQRMELAEEQKARDGLAAALKQTQRLGQLL
FT                   HNLLDLSRLSSGKLMLDVAPVDLSDLVHEVVERFAEQAAEAGCKLEFGAELGLVGRWDR
FT                   LRLDRVVTNLLSNALKFGRGRPVEVRVEHAGVARARLCVRDHGVGIAPEAQRRIFERFE
FT                   REPSGGQHAGFGLGLYIVRQLVEAHGGTIRVESAPSEGATFIVELPLMLLGSELREPPD
FT                   IPLHS"
     gtggcacgtc cgtggacgtt cgcgcagcgc gcgggcgccg gcttcatcat ctcgttggtg        60
     gtggcgctcg tgctggcggg aacgtccgtg gtggcgctgc tctccgtgcg ggccaatcac       120
     aaggcgcgca tcctggagct gtcccgggac gtgctggaca tcaaacaact ggagcggacc       180
     ttcaacgaca aggtcgtcag tggccggggc ttcgctttgt cgggagatac cttcttcgcc       240
     caggacatgt ccgtcgcgcg cgagcgcttc atcgccacct acgaagccct gaagcgccgg       300
     ctcacccagg agcccctggc cactcaattg gaggccgtct cccacgcgga gctggagcac       360
     gaggaggcca tgcaggcgct catcatggag cgcgaggacg gcgtgccccg ccagcggctg       420
     gagcagattt tcgacggcca cgtggcggac acgcgccgcc gtgtcatgga cagcctccgg       480
     atgctccacc agcagacgga gacccggctg tccgagggca ttcatgagag cctggccacg       540
     gaccgcagcg cgcttgggct gtccctgctc gcggggagcc tgggcctcgc gggcgccacg       600
     atgctggcgt ggacgctgac gcgcaagctg cggcccatcc aacaggaggc cgaggccagc       660
     gccgagcgct ttcagctcct cgtggagggg gtgcgcgact acgccttgtt cctgctggat       720
     gcgcggggcc gggtggagag ctggaacccg ggcgcggagc gcatcatggg ctaccgggag       780
     gcggaaatcc tgggccagcc ctccagcgtc ttctacccgc cggatgcggt tgcggcgggg       840
     attccggaca aggacctggt gcgggcccgg aaggatgggc ggctgcacac ggagggctgg       900
     cgagtgagga aggacggctc gcgctatctg gcggacgtca acgtcaccgt gctccaggac       960
     gcgcgcgggc tgccgcgcgg cttcgccaag gtgacgcgcg acatcaccga gcggcgccgg      1020
     gccgagcgca cgcagcaact gctggcggag gcgggaggcc tcttccacca gttccaggac      1080
     ccagaccaga cggtggccga gctgacgcgc atcatggtgc cggaggtggc ggacgcctgc      1140
     ctgctctacc tgctgtcggc cagtggtgac ctctggcctc gcgcggtggc gcacgcgatg      1200
     ccggagaagg aggcgtggct atgggacgcg gcgcggcgct ttccgccgcc accagagtct      1260
     ccatggggca tctggcaggt gatgcgcacg gggcgctccg agctcaagag cgacgtgtct      1320
     ccggagaccc tggcccgggg gctggtgggc cccgagcacc tctcgttgat ggagaaggtg      1380
     ggcgtgcgct cctacctcgg cgtgccgctg cgggtggggc ggcagactcg cggggtgttt      1440
     gtgctgctga cgtccgcgcc ggagcgccgg ctgacggtga cggaccaggt cttcgtggag      1500
     gaggtggcgg gacgtgccgc gctcgcgctg gacaacgccc ggctctggag cgaggcgcag      1560
     gacgcggtgg agctcatcgg cgtggccgcg cacgacttgg gcaatccgtt gaacacgctg      1620
     cagttgctcc tgcgaaggct tcagcggatg gaactcgcgg aggagcagaa ggcgcgcgac      1680
     gggctggcgg cggcgctgaa gcagacgcag cggctggggc agctgctgca caacttgctg      1740
     gacctgtcgc ggctgtcatc gggaaagctg atgctggacg tggcgccggt ggacctgtcg      1800
     gacctggtgc acgaggtggt ggagcgcttc gccgaacagg ctgcggaggc gggctgcaag      1860
     ctggagttcg gcgcggaatt ggggctggtg ggccggtggg accggctgcg gttggaccgg      1920
     gtggtgacga acctcttgtc caacgcgctg aagttcggga gggggcggcc ggtggaggtc      1980
     cgggtggagc acgcgggcgt ggcgcgggcg cggctgtgcg tgagagacca cggcgtgggc      2040
     attgccccgg aggcgcagcg gcgcatcttc gagcgcttcg aaagagagcc ctccggcggc      2100
     cagcatgcgg gcttcgggct cgggctctac atcgtccggc agttggtgga ggcgcacggc      2160
     ggcaccatcc gcgtggagag tgcccccagc gagggcgcca ccttcatcgt ggagttgccg      2220
     ctgatgctgc tgggctcgga gctgcgtgag ccacccgata ttcccctgca ctcgtga         2277
//

If you have problems or comments...

PBIL Back to PBIL home page