(data stored in ACNUC30630 zone)

EMBL: CP000113.PE581

CP000113.PE581       Location/Qualifiers
FT   CDS_pept        690915..692597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAD01926.1; match to
FT                   protein family HMM PF03235; match to protein family HMM
FT                   PF07510"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90819"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEQ6"
FT                   /protein_id="ABF90819.1"
FT                   /translation="MDIKGEQRPIQKVFCDDFVLRVPHYQRPYAWKLENAQELLSDLLA
FT                   FMGGGSTKVDELPPYFLGSIVLVKDDAWPEAEVIDGQQRLTTLTILLAALRASTGAAFG
FT                   SDLTKYLYQPGSLVEGTPDQYRLRLRDRDAEFFREFVQAVDGPAKLKALTREIPDAQQR
FT                   IRENALLFLRELDALPVERRQRLASYLVRRCYLVVVSTPDADSAYRIFSVLNDRGLDLS
FT                   HADILKADIVGKIDGEALQKAYATKWEEVEEEIGRDAFKDLFGHLRMIHRRAKLEGTVL
FT                   AEFRKYVVDKAPEPRKLVDDVIVAGAWAYDQIRRCSWDGQSDDATQAKIEELLEWLNRL
FT                   DNEDWVPPAIRVMQLSADATKVLRHLEALERLAAFLLIKRSNVNERIHRYANVLEAIEN
FT                   GTAIDAGGPLLLSTDEEKQLVDALDGEVYLEQKVRVYVLLRLDRALGDKGAKYDVDTIT
FT                   VEHVLPQNPRDKSEWLTNFPRPEDRAWTHRIGNLLLLPRRKNSEASNWDFGEKKKRYFT
FT                   SKKGVSTFALTSQVLKESAWTPDVVARRQTEAIDTLKKVWSLK"
     atggacatca agggtgagca gcgaccgatt caaaaggtgt tctgcgacga ctttgtcttg        60
     cgagtgccgc actaccagcg gccgtacgcc tggaagctcg agaatgctca ggaactcctc       120
     tccgacctgt tggcgttcat gggcggcggc tcgaccaaag ttgacgagct ccccccgtac       180
     tttctcggga gcattgttct cgtaaaggac gacgcgtggc ccgaggcgga ggtgatcgac       240
     ggccagcagc gcctcaccac gctgacgatc ctcctcgcgg cactgcgtgc gtcgacgggg       300
     gctgcgttcg gcagcgacct gaccaagtat ctgtaccaac cgggaagcct cgtggaaggt       360
     acgccggacc agtaccgtct ccggctgcgc gaccgcgacg ccgagttctt cagggagttc       420
     gtccaggccg tcgatgggcc agcgaagctg aaggcgctga cgcgcgaaat ccccgatgcg       480
     cagcaacgta ttcgggagaa cgcgctgttg ttcttgcgcg aactggacgc gctgcccgtt       540
     gagcgccgac agcgcttggc gagctatctc gtgcggcgct gctatctggt cgtggtgtcg       600
     acgcccgacg ccgactcggc gtatcgcatc ttctcggtgc tgaacgatcg cggcctcgac       660
     ctctcgcacg ccgacatcct caaggccgac atcgttggga agattgacgg cgaggccttg       720
     cagaaggcct acgccacgaa gtgggaagag gtcgaagaag agattgggcg cgacgcgttc       780
     aaggatctct tcgggcacct ccgaatgatt catcgtcggg cgaagctcga ggggaccgtc       840
     ctcgccgagt tccgaaagta cgtcgtagac aaggcgcccg agcccaggaa gctcgtggac       900
     gacgtcatcg tcgctggcgc ttgggcgtac gaccagatcc gtcggtgcag ttgggatggc       960
     caatccgatg acgcgacgca ggcgaagatc gaggagctgc ttgagtggct caatcgcctc      1020
     gacaacgagg actgggttcc tcctgcgatc cgcgtcatgc agttgagcgc tgacgccacg      1080
     aaggtgctac gccacctcga ggcgcttgag cgtctcgccg cgttcctgct catcaagcgc      1140
     tccaacgtga acgagcgcat ccacaggtac gcgaacgttc ttgaggccat cgagaatggg      1200
     acagccattg acgcgggggg cccgctcctt ctctccaccg acgaagagaa gcaactcgtg      1260
     gacgcgctcg atggcgaggt ctacctcgag cagaaggtgc gcgtgtacgt ccttctccgg      1320
     cttgaccgag ccctgggcga caagggcgcg aagtacgacg tcgacacgat caccgtcgag      1380
     catgtgcttc cgcagaaccc gcgtgacaag agtgagtggt tgacgaattt ccctaggccc      1440
     gaagatcggg cgtggacgca tcgcatcgga aacttgctcc tgctgcctcg ccgtaagaac      1500
     tccgaggcga gcaactggga cttcggcgag aagaagaagc ggtacttcac ctctaagaag      1560
     ggggtgagca cgttcgcact cacctcgcag gtgctgaagg agtccgcttg gacgcctgac      1620
     gtcgtggcgc gccgccagac cgaggccatc gacaccctca agaaggtgtg gtcgctcaag      1680
     tag                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page