(data stored in ACNUC30630 zone)

EMBL: CP000113.PE59

CP000113.PE59        Location/Qualifiers
FT   CDS_pept        complement(71629..71988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86884"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG78"
FT                   /protein_id="ABF86884.1"
FT                   /translation="MDKVNLAQKLALFSEHWSPKVVGELNGQHVRLARLHGPFVWHQHD
FT                   AEDELFLVLHGQLRMELRERTVDVGPGEFIIIPRGVEHRPVAEEEVHVLLFEPATTLNT
FT                   GNVREERTAEHLQQL"
     gtggacaagg tcaacctcgc gcagaagctg gccctcttct ccgagcactg gtccccgaag        60
     gtggtgggcg agctgaacgg ccaacacgtc cggctggccc ggctccacgg ccccttcgtc       120
     tggcaccagc acgacgccga ggatgagctg ttcctcgtgc tccacggcca gctgcgcatg       180
     gagctgcgcg agcgcacggt ggacgtgggc ccaggcgagt tcatcatcat tcctcgcggc       240
     gtggagcacc ggcccgtggc ggaggaggag gtccacgtcc tgctcttcga gcccgccacc       300
     acgctcaaca ccggcaacgt ccgcgaggag cggacggccg agcatctgca gcagctctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page