(data stored in ACNUC30630 zone)

EMBL: CP000113.PE604

CP000113.PE604       Location/Qualifiers
FT   CDS_pept        719871..721493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0622"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86337"
FT                   /db_xref="GOA:Q1DEN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEN3"
FT                   /protein_id="ABF86337.1"
FT                   /translation="MIRLDNISKQNGQQILFIEASAALHKGEKVGLVGPNGAGKTTLFR
FT                   MITSQEHPDEGQVAVDRGVTIGYFSQDVGEMEGRSAAAEVMDGAGPVSTVAAELKELEA
FT                   AMADPDQADNMDKLVERYGLVQGRFEELGGYALEGRAREILAGLGFTQEMMDGDVGALS
FT                   GGWKMRVALARILLMRPDAMLLDEPSNHLDIESLIWLEEFLKNYDGALLMTSHDREFMN
FT                   RIVNKVVEIDGGSLSTYTGNYEFYEQQRAMNEKQQQAQFERQQAMLAKELKFIERFKAR
FT                   ASHAAQVQSRVKKLEKIERVEPPKRRQTVLFEFQPAPRSGDDVVSLKGVHKAYGSRTIY
FT                   EGLDFLVRRTERWAVMGVNGAGKSTLLKLVTGSTQPDTGNVALGGSVKMGYFAQHAMDL
FT                   LDGERTVFQALEDAFPRAGQGSLRALAGCFGFSGDEVEKKCRVLSGGEKARLVMAKMLF
FT                   DPPNFLVLDEPTNHLDMATKEMLITALSRYEGTMLFVSHDRHFLAALSNRVLELTPEGI
FT                   HQYGGGYTEYVARTGQEAPGLRS"
     atgattcgtc tcgacaacat cagcaagcag aacggccagc agattctctt catcgaggcc        60
     tccgcggcgc tccacaaggg ggagaaggtg ggcctcgtcg gacccaacgg ggccggcaag       120
     acgacgctgt tccggatgat taccagccag gagcaccccg acgagggcca ggtcgccgtc       180
     gaccggggcg tcaccattgg ctacttcagc caggacgtgg gtgagatgga gggccgcagc       240
     gccgccgccg aggtgatgga cggcgcgggc ccggtcagca cggtggccgc cgagctgaag       300
     gagctggagg ccgccatggc cgacccggac caggcggaca acatggacaa gctcgtggag       360
     cgctacggcc tggtccaggg gcgcttcgag gagctgggtg gctacgcgct ggaaggccgc       420
     gcgcgggaga ttctcgcggg cctgggcttc acccaggaga tgatggacgg cgacgtgggc       480
     gcgctgtcgg gtggttggaa gatgcgcgtg gcgctggccc gcatcctcct gatgcgtccg       540
     gacgcgatgc tgctcgacga gccgagcaac catctcgaca tcgagagcct catctggctg       600
     gaggagttcc tcaagaacta cgacggcgcg ctgctgatga cgtcgcacga ccgcgagttc       660
     atgaaccgca tcgtgaacaa ggtggtggag atcgacggcg gctcgctgtc gacgtacacc       720
     ggcaactacg agttctacga gcagcagcgg gcgatgaacg agaagcagca gcaggcgcag       780
     ttcgagcgcc agcaggccat gctcgccaag gagctgaagt tcatcgagcg cttcaaggcg       840
     cgcgcctcgc acgccgcgca ggtgcagagc cgggtgaaga agctggagaa gattgagcgc       900
     gtggagccgc ccaagcggcg tcagacggtg ctcttcgagt tccagccggc gccgcgctcg       960
     ggcgacgacg tggtgagcct gaagggcgtt cacaaggcct acggctcgcg gaccatctac      1020
     gaggggctgg acttcctggt gcgccgcacg gagcgctggg ccgtcatggg cgtcaacggc      1080
     gcgggcaagt ccacgctgct gaagctggtg acgggctcca cgcagccgga cacgggcaac      1140
     gtggcgctgg gtggcagcgt gaagatgggt tacttcgcgc agcacgccat ggacctgctg      1200
     gacggcgagc ggaccgtgtt ccaggcgctg gaggacgcct tcccccgcgc gggtcagggc      1260
     tcgctgcggg cgctggccgg ctgcttcggc ttctccggcg acgaggtgga gaagaagtgc      1320
     cgcgtgctgt ccggtggtga gaaggcccgg ctcgtcatgg cgaagatgct cttcgacccg      1380
     ccgaacttcc tggtgctgga cgagcccacc aaccacctgg acatggccac gaaggagatg      1440
     ctgattacgg cgctctcccg ctacgagggg acgatgctgt tcgtctccca cgaccgtcac      1500
     ttcctggccg cgctgtccaa ccgcgtgctg gagctgacgc ccgagggcat ccaccagtac      1560
     ggcggcggct acacggagta cgtcgcgcgc accggccagg aagcgcccgg tctgcggagc      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page