(data stored in ACNUC30630 zone)

EMBL: CP000113.PE610

CP000113.PE610       Location/Qualifiers
FT   CDS_pept        726712..727344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0628"
FT                   /product="phospholipase domain protein"
FT                   /note="identified by match to protein family HMM PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91835"
FT                   /db_xref="GOA:Q1DEM7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM7"
FT                   /protein_id="ABF91835.1"
FT                   /translation="MRPIEAELLSGSALYREVVLEKLLHARESVWMATANVKAMFVEHG
FT                   GRFVPLVDVLDTLAARGVALRLLHAELPSRPFRAAFDRQARLVAGGLSLKVCPRVHFKA
FT                   VVVDGAWAYLGSANLTGAGLGAKGDSARNFELGFVTEDFDVIDRVTALYEAVWSGAECK
FT                   SCKLRAVCPDPILPAGKRAPTPRRPRADAPRLGKARRLQRGTKAATR"
     atgcgtccca tcgaggcgga gctcctgtcg ggcagcgcgc tgtaccggga ggtggtgttg        60
     gagaagctgc tccacgcccg ggagtcggtg tggatggcca cggccaacgt gaaggcgatg       120
     ttcgtggagc acggtggccg cttcgtcccg ctggtggacg tgctggacac gctcgccgcg       180
     cgtggcgtgg cgctgcggct gttgcacgca gagctgccga gccggccctt tcgcgccgcc       240
     ttcgaccggc aggcgcggct ggtggcgggg ggcttgtcgc tcaaggtctg tccgcgcgtg       300
     cacttcaagg cggtggtggt ggatggcgcc tgggcatacc tgggcagcgc caacctcacc       360
     ggcgcggggc tgggcgccaa gggcgactcc gcgcgcaact tcgagctggg cttcgtcacc       420
     gaggacttcg acgtcatcga ccgggtgacg gcgctctacg aagcggtgtg gagcggcgcc       480
     gagtgcaagt catgcaagct ccgcgcggtg tgtcccgacc ccattctgcc cgcaggcaag       540
     cgagcgccca cgccgcgccg tcctcgcgcg gatgccccac gtctgggcaa ggcgcgccgt       600
     cttcagcggg gcacgaaggc cgccacgcgt tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page