(data stored in ACNUC30630 zone)

EMBL: CP000113.PE611

CP000113.PE611       Location/Qualifiers
FT   CDS_pept        complement(727476..728174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0629"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABF93075"
FT                   /db_xref="GOA:Q1DEM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM6"
FT                   /protein_id="ABF93075.1"
FT                   /translation="MKAVPPASRKERSAVIQARDLGAGYGPRAVLAKLSFDLPWRRASV
FT                   VLGPGGSGKSTLLRALVNDRLGDGADFWVRGQLTLPVSAQAVVPQGRPAESRTLGELLG
FT                   PDARQTLESVWACAPAAAVRLDRLRERPVALLPEGLWRLALLTVAIANKAPLVLLDEPE
FT                   VGLSGDGVRWLARRLLMLRAERTVVLVTQHLPLARMVADHVLLLDEGMLVDQAPPRHFF
FT                   DEPELRRHTC"
     ttgaaagccg tccccccggc atcaagaaag gagcgcagcg ccgtgattca agccagggac        60
     ctgggcgccg gctatggccc tcgcgcggtg cttgcgaagc tctctttcga tttgccctgg       120
     cggcgcgcca gcgtggtgct gggcccgggt ggcagtggca agagcaccct gctgcgggcc       180
     ctggtcaacg accggctcgg agacggcgct gacttctggg tgcggggcca gctcaccctt       240
     cccgtatcgg cgcaggcggt ggtgccccaa ggccggcccg cggagtcccg cacactgggc       300
     gagctgctcg gccccgatgc gcgccagacg ctggagtccg tgtgggcctg cgcgccagcg       360
     gcggcggtgc ggctggaccg cctgcgcgag cggccggtgg cgctgctgcc cgaagggctg       420
     tggcggctgg ccctgctcac cgtcgccatc gccaacaagg cgcccctggt cctcctggac       480
     gagcccgaag tgggactgtc gggagacggc gtccgctggt tggcgcggcg gctgctgatg       540
     ctgcgggccg agcgcacggt ggtgctcgtc acgcagcacc tcccgctggc gcgcatggtc       600
     gccgaccacg tgctgctcct tgatgaaggg atgctcgtgg accaggcccc gccccgtcac       660
     ttcttcgacg agcctgagct ccgtcgccac acctgctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page