(data stored in ACNUC30630 zone)

EMBL: CP000113.PE614

CP000113.PE614       Location/Qualifiers
FT   CDS_pept        complement(730342..731292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0632"
FT                   /product="fatty acid desaturase family protein"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91529"
FT                   /db_xref="GOA:Q1DEM3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM3"
FT                   /protein_id="ABF91529.1"
FT                   /translation="MARGVKQPLLGGRTECFMTPARPPPPSADLPQLAVHALWWGWFPA
FT                   FILSWDALPWVGRLAMCLLGWAICFWNYAVLHNHMHVSIARPPLAHWVVSRSLGMACGF
FT                   PYRGYFIHHFNHHRYDDGPGDWGRRRPGERVFRYCLRSALTPWLWPYETLGQVWQWAKK
FT                   KNQRLELAVDFLVVDGALLALIVWKPALGLALWGVLLVTQFCIHWLNLAAHFETDSEQK
FT                   DALGTTSYSAFYNRWFFNAGYHQAHHLKPQVPWYELPALTEELARTSRLRPELTTGLSP
FT                   INPLWVARVVKRYSAKPCDRQTESKITAGTPTAVT"
     ttggcgcgtg gagtgaagca gccgctgctg ggggggcgta ctgaatgctt catgaccccc        60
     gcccgccccc cgcccccttc agccgacctg ccgcagctcg cagttcatgc gttgtggtgg       120
     gggtggttcc cagccttcat cttgagctgg gacgcgcttc cctgggtggg gcggctggcc       180
     atgtgcctgc tgggctgggc catctgcttc tggaactacg ccgtcctgca caaccacatg       240
     cacgtgtcca tcgcacggcc tccgctggcg cactgggtgg tgtcccgttc gctgggcatg       300
     gcgtgtgggt tcccctaccg gggctacttc atccaccact tcaaccacca ccggtacgat       360
     gacggcccgg gcgactgggg ccgccgccgt cccggagagc gcgtcttccg ctactgcctg       420
     cgctcggcgc tgacgccgtg gctgtggccc tacgagacgc tgggccaggt ctggcagtgg       480
     gcgaagaaga agaaccagcg gctggagctg gcggtggatt tcctggtggt ggacggcgcg       540
     ctgctggcgc tcatcgtgtg gaagcccgcg ctgggcctgg ccttgtgggg ggtgctgctg       600
     gtgacgcagt tctgcatcca ctggctcaac ctggcagccc acttcgaaac ggactccgaa       660
     cagaaggacg ccctggggac cacgtcctat tccgccttct acaaccggtg gttcttcaac       720
     gccggctacc atcaggccca tcacctgaag ccgcaggtgc cctggtacga gctcccggcc       780
     ctcaccgagg agctcgctcg gacgtccagg ctccgtccag agctgacgac cgggctctcc       840
     cccatcaatc cgttgtgggt ggcacgggtg gtgaagcgct attctgccaa gccgtgcgat       900
     cggcagacgg agtcgaagat taccgccggg acccccacgg ccgttaccta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page