(data stored in ACNUC30630 zone)

EMBL: CP000113.PE615

CP000113.PE615       Location/Qualifiers
FT   CDS_pept        complement(731387..731791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0633"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91220"
FT                   /db_xref="GOA:Q1DEM2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEM2"
FT                   /protein_id="ABF91220.1"
FT                   /translation="MRGDEALFSTGFPHAMEQRLATLIGNAVRAARQRLELTQADVAER
FT                   VGIATEVYGRLERGHMLPSVRTLRKLCLVLNCSSDVLLGMAGVEGAPTLAEDPPEYRER
FT                   PEVRRLLRTVRKLDAPRLRLLGQVANALET"
     atgcgggggg acgaagccct cttttcgaca ggttttccgc acgccatgga acaacgactg        60
     gcaaccctca ttggaaacgc ggtccgcgcg gcgcgacaac ggctggagct gacccaggct       120
     gacgtggccg agcgcgttgg catcgccacc gaggtgtatg gccgcctgga gcgcggccac       180
     atgctcccca gcgtccgcac gttgcgcaag ctgtgcctgg tgctcaactg ctcgtcggac       240
     gtgctcttgg gaatggcggg cgtggaaggc gcgcccacgc tggcggagga tccgccggaa       300
     taccgcgagc gcccggaagt ccgccggctg ctgcgcacgg tgcgcaagct ggacgcaccg       360
     cgtcttcgcc tgttggggca ggtggcgaac gcgctcgaga cgtag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page