(data stored in ACNUC30630 zone)

EMBL: CP000113.PE618

CP000113.PE618       Location/Qualifiers
FT   CDS_pept        735222..736436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0636"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABF89666"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL9"
FT                   /protein_id="ABF89666.1"
FT                   /translation="MKKAFEQNVSRAKPRLRLGALTGLVDPVEPTPPEPEAEATPEPVA
FT                   EAPDLSAEVRARIERARTPRPSAAQAMDAALREPDDAPVYEEPPPEPEAVADVPVTYGA
FT                   PPEAEALLDTEPHAGPVTFAAPPPALHFDAVSPPPEAHPMTQASAPVSMPHVTATVAEP
FT                   VARVEAPPTEVEVQRPAPPREDGQDSSARRERLKARLKAVRENPRPEPLPATVAEAGQR
FT                   AVERITHLQAELVKVKALNLSLTQDLEVSRRQAEKATEEARLRMDEARRLSSEMEGRVK
FT                   LLADLERELSALEGERDEALLSLQETRQALQAAAKEREALEEEVARGKQSLVDSLAEEE
FT                   RLAGELESAKDESTSLHRAVEALQGERDVLAQQVASLTAERAELLEARKALESVHRALS
FT                   QATVR"
     atgaagaaag cctttgaaca gaacgtgtcc cgcgccaagc cgcgcctccg cctgggcgcg        60
     ctgacgggcc tcgtcgaccc cgtcgagccc acgcctcccg agcccgaggc cgaagcgacc       120
     cccgagcccg tcgccgaggc ccccgacctc tccgccgagg tacgcgcccg catcgagcgc       180
     gcccgcaccc cgcgccccag cgccgcccag gccatggacg ccgccctgcg cgagccggac       240
     gacgcgcccg tctacgagga gccgccgccg gagcccgaag cggtcgccga cgtgcccgtg       300
     acgtacgggg ctccgccgga ggcggaggcg ttgctcgaca ccgagccgca cgccgggccc       360
     gtcaccttcg ccgcgccgcc tcctgcgctg cacttcgacg ccgtcagtcc tcctccggag       420
     gcgcacccca tgacgcaggc ctcggctccc gtgtccatgc cgcacgtcac cgccaccgtc       480
     gcggagccgg tggcccgtgt cgaagcgccg cccaccgagg tggaggtgca gcggccggcc       540
     ccgccgcgcg aggacgggca ggactcctcg gcccgccgtg agcgactgaa ggcccggctc       600
     aaggcggtgc gggagaatcc gcgcccggag ccgctgcccg ccaccgtggc ggaggcgggt       660
     cagcgcgccg tggagcgcat cacccacctc caggcggagc tggtgaaggt gaaggcgctc       720
     aacctctccc tcacgcagga cctggaggtg tcgcgccgtc aggcggagaa ggccacggaa       780
     gaggcccgcc tgcgcatgga cgaggcgcgc cgcctgtcct cggagatgga gggccgggtg       840
     aagctgctgg ccgacctgga gcgcgagctg tccgcgctgg agggcgagcg cgacgaggcg       900
     ctgctgtcgc tccaggagac gcggcaggcg cttcaggccg ctgccaagga gcgcgaggcc       960
     ctggaagaag aggtcgcccg cggcaagcag tccctggtgg acagcctggc cgaggaggag      1020
     cggctcgccg gtgagctgga gtccgccaag gacgagtcca cgtcgctgca ccgcgcggtg      1080
     gaagcactcc agggagagcg cgacgtgctg gctcagcagg tggcctcgct caccgccgag      1140
     cgcgccgagt tgctcgaggc gcgcaaggcc ctggagtcgg tgcaccgggc cctgagtcag      1200
     gccacggtgc gctga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page