(data stored in ACNUC30630 zone)

EMBL: CP000113.PE62

CP000113.PE62        Location/Qualifiers
FT   CDS_pept        complement(74587..76128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92472"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG75"
FT                   /protein_id="ABF92472.1"
FT                   /translation="MRAGHLLGRAAARAGVEPPRRGPHPCPASEPRTPPPWEERGAPAR
FT                   HAPRRSPAHRRTPDRGPRHARRPAPVRGPRPVAGTKQGGVGSLPPPASRPARPAAPRRR
FT                   ARPACPPVRTGPRSPRVSRSRAAGGRRASGSAAFACAPRHRACLERHGSPALLPRSLPP
FT                   FPPGQHDGSASNRARKSPRAFNLGGVGRAGGHTRHKAPRSPLCSHTKDRTRRSRGRWAT
FT                   PTWASCPDRATWPTSPRLNCWRARSPRSSANRPRAWGLHGHGLAWVELHLLGLARPGLR
FT                   VRLLRGVPALARGLDLRLHRRLAVVTLPIRVAVPDAIHMVTPTGVHPFLRARGGIEHRG
FT                   CHLHRCLCLLLLHGSRLQRHRQENPTKETHRPPPTWMLRNGWEWNPDVTSPGAFGASPS
FT                   ALGLTFARPGTSRPRPRAAPNSLAFPPVPPASSAPVFGFRLLASASLDAPVAAACSSHL
FT                   GNKSHELEAAAGEGLRGPLRPGEDQEHEGRCGPVPVRQVAVGGGPRATWTGGLCL"
     gtgcgggccg gtcaccttct gggacgagca gccgctcgcg caggtgttga accacctcgg        60
     aggggtccac acccgtgtcc cgcatccgag ccaaggacgc cgccgccttg ggaagaacgt       120
     ggcgctccag cgcgacatgc gccgcggcgt tcccccgcac acaggcgcac gccagataga       180
     ggtccgcggc atgcacggag gccagcaccc gtgaggggtc ctcgtcccgt ggcaggcacg       240
     aagcaaggtg gcgtaggaag tcttcctccg ccagcgtcac gcccggccag gcctgccgcg       300
     ccgcggcgca gagcgcgacc agcgtgtcct ccagtccgga cagggcctcg tagccctcgc       360
     gtgtcccgga gccgagctgc tggaggaaga cgagcgagcg gctctgctgc gttcgcatgc       420
     gcacctcggc accgcgcgtg cctggaacgg cacggctcac ccgccttgtt accccgttcc       480
     ctccccccgt ttccacccgg ccagcacgac ggctcggcga gcaaccgcgc caggaagtcg       540
     ccaagggcct ttaacttggg cggcgtgggg cgcgcgggcg gccacacccg ccacaaggct       600
     ccccgctccc ccctgtgctc gcacacgaag gaccggacgc ggcgctcgcg cggacgctgg       660
     gccacgccca cctgggcatc ctgcccggac agggccacgt ggcccacgtc accgcgcctg       720
     aattgctggc gcgcgaggtc tccgcgttcc tccgcgaatc gcccgcgcgc ctggggccta       780
     catggacacg gacttgcttg ggtcgagctg catcttctcg ggctcgcgcg tccgggcctg       840
     cgtgtccgcc ttcttcgagg cgtcccggct cttgcgcggg gcctcgacct ccgccttcac       900
     cggcgcctcg cagtggtcac ccttccgatt cgggtggcag tgccggatgc catacacatg       960
     gtgacaccca caggggtcca cccgtttctt cgcgcacgcg gagggattga acaccggggc      1020
     tgccacctcc accggtgtct gtgcctgctc cttctccacg ggtcccgcct gcaacgccac      1080
     cgccaggaaa atcccaccaa ggaaacccat cgcccacccc ctacctggat gctgcggaat      1140
     ggatgggaat ggaatccgga cgtgacaagt cccggggcgt tcggagcctc gccgtccgct      1200
     ctcgggctga ctttcgcccg gccgggcacg tcccggccgc ggccgcgtgc ggctccgaat      1260
     tcgctcgcct tcccgcctgt gcccccagca tcctctgctc ctgttttcgg gtttcggctc      1320
     ctggcgtcag cttccctgga cgctcccgtc gctgccgcgt gttcatccca tctggggaat      1380
     aagagtcatg agttggaagc agcggctgga gaaggtctca gagggccatt acgtcctggc      1440
     gaagaccaag agcatgaagg tcgatgcgga cctgttcctg tccgacaagt tgctgtgggg      1500
     ggagggcccc gagcaacctg gactggagga ctctgtcttt ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page