(data stored in ACNUC30630 zone)

EMBL: CP000113.PE623

CP000113.PE623       Location/Qualifiers
FT   CDS_pept        741355..741924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0641"
FT                   /product="TspO/MBR family protein"
FT                   /note="identified by match to protein family HMM PF03073"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABF87387"
FT                   /db_xref="GOA:Q1DEL4"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL4"
FT                   /protein_id="ABF87387.1"
FT                   /translation="MLRQGRTRMDWTLEPTTRNMPDPVRRTALNPTLRKESVVALGVFG
FT                   ALTLGAAALGARVSSADTRWYRRLHKPSFQPPPKVFGPVWTVLYGLIALSGWRVWTAPA
FT                   GAARSQALAWWGIQMGCNAAWSWLFFGRHQPRRALADNLALLASVTAYVAVTKDVDRPA
FT                   AWMVVPYLGWVGFANVLNAEIVRLNP"
     gtgctccgcc aagggaggac gcggatggac tggacgctgg agccgacgac gcgaaacatg        60
     cctgacccgg tgcggcgcac ggcgctcaac cccacgctgc gcaaggagtc cgtggtggcg       120
     ctgggcgtct tcggcgctct gacgttgggc gcggcggccc tgggcgctcg cgtcagctcg       180
     gcggacacgc gctggtaccg gcgtctgcac aagccctcgt tccagccgcc accgaaggtc       240
     ttcggtccgg tatggacggt gctgtatggc ctcatcgccc tttctggttg gcgtgtatgg       300
     acggcgcccg cgggcgcggc ccgctcccag gccctggcct ggtggggcat ccagatggga       360
     tgcaacgccg cctggtcctg gctcttcttc ggcagacacc agccgcgccg cgccctggcg       420
     gacaacctgg cgctgctggc cagcgtgacg gcgtatgtcg ccgtcaccaa ggatgtggac       480
     cgccctgcgg cctggatggt ggtgccgtac ctgggctggg tgggcttcgc caacgtgctc       540
     aacgccgaaa tcgtccgcct caacccctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page