(data stored in ACNUC30630 zone)

EMBL: CP000113.PE626

CP000113.PE626       Location/Qualifiers
FT   CDS_pept        complement(743996..746644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0644"
FT                   /product="peptidase, M1 (aminopeptidase N) family"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF01433;
FT                   match to protein family HMM PF03130"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABF90010"
FT                   /db_xref="GOA:Q1DEL1"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEL1"
FT                   /protein_id="ABF90010.1"
FT                   /translation="MPMRCCHRHASESVPSGPRPFSLPGATEHYAAERPVRAEHVRIEV
FT                   DLDFDTHRITGLCTTRVSAVRPVHTLTFDAVDLDVSDVQVDGRAARFSNSGAHVRVELS
FT                   APLAAGQACEVAIRYTARPRRGLYFWAPDAAYPHRPHQAWTQGQDIDARAWFPCLDTPA
FT                   QKATSEVIATFPEAMTSLSNGTLESDRVHDGRRTQHYRMAQPHAPYLVTLVVGEFEEAT
FT                   DTAGTVPLRYLFPKGRKEDALRCVRRTPEMVRVFQEVTGEPYPWSSYAQVFVTEFILGG
FT                   MENTSATSLTDTVLHDARAQPDYNAEPLISHELAHQWFGDLLTCRDWPHGWLNEGFATW
FT                   LEMLWKERADGQDEADQHRLVDLEAYLGEARERYARPIVARRFHAPMDVFDRHLYEKGG
FT                   LVLHELRRRLGDDLFFKGLRHYVARHRHGSVETVDLARAFEDATGHNLDAFFDQYIFAP
FT                   GHPELKVDVRYDAEEARLRLQVRQTQSTADGVPLFRLPLDVALTVDGRDTVHRLEVTDA
FT                   EHAFHLPCPSAPSQVRVDPRRGVLGTLTVDKSAGLWMDELRAAPEMRARTEAAVALGRD
FT                   GSPRAVDALGTALADARLFWGTRAACAKSLGRIRTPDSRARLLDALSTEHPRVRRAVVA
FT                   SLGEFRRDAEVTARLRALVNGGDTSYFVEAEAARSYGRVRAPDALGVLEAASTRPSYQD
FT                   VIAVGAVDGLAESQDPAAFSVVLARTAYGHAAPLRRAATLAVAKLAEVAGRKREAVDLL
FT                   AELLRDPLFRVRMGVFEAARTLGDSRLVPALEQTPLLDAVARRAARETVRFLREGEPQV
FT                   REVASLREEVDRLKEETRALRERLEGLSLKPPEPPRPPRGGAKPARKQVTARTKTAARK
FT                   AGGRKRKATRR"
     gtgcccatgc gctgctgcca ccgtcacgcc tccgagtccg tcccctccgg cccccgtccc        60
     ttctcccttc ctggcgccac cgagcactac gccgccgagc ggccggtccg cgccgagcac       120
     gtccgcatcg aggtcgacct cgatttcgac acccaccgca tcaccggcct gtgcaccacg       180
     cgcgtctccg ccgtccgtcc agtccacacc ctcaccttcg acgcggtgga cctcgacgtg       240
     tccgacgtcc aggtagacgg ccgcgccgcg cgcttctcca actccggcgc ccacgtccgc       300
     gtggagctgt ccgcgccgct cgccgccggg caggcctgtg aggtggccat ccgctacacg       360
     gcccggcctc gccgcggcct ctacttctgg gcgcccgacg ccgcctatcc gcaccgtccc       420
     caccaggcct ggacacaagg ccaggacatc gacgcgcgtg cctggttccc ctgcctggac       480
     acgcccgccc agaaggccac gtccgaggtc atcgccacct tccccgaggc gatgacgtcc       540
     ctgtccaacg gcacactgga aagcgaccgc gtccacgatg gccgccgcac ccagcactac       600
     cggatggcgc agccgcacgc cccgtacctc gtcacgctcg tggtgggtga attcgaggag       660
     gccaccgaca cggctggcac ggtgcccctg cgctacctct tccccaaggg ccgcaaagag       720
     gacgcgctgc gctgcgtgcg ccgcacgccg gagatggtgc gcgtcttcca ggaagtcacc       780
     ggcgagccct acccctggag cagctacgcc caggtcttcg tcaccgagtt catcctgggc       840
     ggcatggaga acacctccgc caccagcctc acggacaccg tcctccacga cgcgcgcgcc       900
     caaccggact acaacgccga gccgctcatc tcgcacgagc tggcccacca gtggttcggg       960
     gacttgctca cctgccgtga ctggccccat ggctggctca acgagggctt cgccacctgg      1020
     ctcgagatgc tctggaagga gcgcgccgac gggcaagacg aggccgacca gcaccggctc      1080
     gtggacctgg aggcctacct gggcgaggcg cgtgagcgct atgcccgccc cattgtcgcg      1140
     cggcgcttcc acgcgcccat ggatgtcttc gaccggcacc tctacgagaa gggcggcctg      1200
     gtcctccacg agctgcgccg ccggctgggc gatgacctgt tcttcaaggg cctgcgccac      1260
     tacgtcgcgc gacaccgcca cggctccgtg gagacggtgg acctggcccg cgcgttcgag      1320
     gacgccacgg gccacaacct ggacgccttc ttcgaccagt acatcttcgc gcccggccac      1380
     cccgagctga aggtcgacgt ccgctacgac gccgaggaag cgcggctgcg cctccaggtg      1440
     cgccagacgc agtccacggc ggacggcgtg cccctcttcc ggctgccgct ggatgtggcg      1500
     ctcaccgtgg acggccgcga caccgtccac cggctggagg tgacggacgc ggagcacgcg      1560
     ttccacctgc cctgccccag cgcgccctcg caggtgcggg tggaccctcg gcgcggagtg      1620
     ctcggcacgc tgacggtgga caagtccgcg ggcctttgga tggacgagct gcgtgccgcg      1680
     ccggagatgc gcgcgcgcac cgaagccgcc gtggccctgg gacgcgacgg cagcccccgc      1740
     gccgtggacg cgctgggcac ggcgctggcg gacgcgcgtt tgttctgggg cactcgcgcc      1800
     gcgtgcgcga agtccctggg ccgcatccgc acccccgatt cccgcgcgcg ccttctggac      1860
     gcgctgtcca ccgagcatcc ccgcgtgcgc cgcgccgtgg tggcttcgct gggcgagttc      1920
     cgccgcgatg cggaggtgac agcccgcctg cgcgccctgg tgaacggcgg tgacaccagc      1980
     tacttcgtgg aggcggaggc cgcccgcagc tatggccgcg tgcgcgcgcc ggacgcgttg      2040
     ggcgtcctgg aggccgcgag cacccggccc tcgtaccagg acgtcatcgc cgtgggcgcg      2100
     gtggatgggc tcgccgagtc tcaggacccc gccgccttct cggtggtgct ggcgcgcacc      2160
     gcctatggcc acgcggctcc gctgcgccgc gccgccacgc tcgcggtggc gaagctggcg      2220
     gaggtcgcgg gtcgcaagcg cgaggccgtg gacctgctgg cggagctgct ccgcgacccg      2280
     ctcttccgcg tgcgcatggg cgtcttcgag gcggcgcgca cgctggggga ttcacgcctg      2340
     gtgcccgcgc tggagcagac gccactgttg gatgccgtcg cccggcgcgc ggcgcgcgag      2400
     acggtgcgct tcctgcgcga aggtgaaccg caagtccgcg aggtggcatc gctgcgcgaa      2460
     gaggtggacc gcctcaagga ggagacacgg gccttgcgcg agcggttgga agggctctcg      2520
     ctgaagcccc ccgaaccgcc gcgtccaccg cgcgggggcg cgaagccggc gcgaaagcag      2580
     gtcactgcgc gcacgaagac agccgcacgc aaggcgggtg gccggaaacg caaggccacg      2640
     cgccgctag                                                              2649
//

If you have problems or comments...

PBIL Back to PBIL home page