(data stored in ACNUC30630 zone)

EMBL: CP000113.PE630

CP000113.PE630       Location/Qualifiers
FT   CDS_pept        complement(749301..749993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91044"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK7"
FT                   /protein_id="ABF91044.1"
FT                   /translation="MLVADPDSALDGVIQVLVVDGDAEGVLVAQGGQLVLLIQARLDVD
FT                   ELVAAVRAHRAHEHVRLAVAVDDVGVVRRLEVDVGDLEEHRVHLPAANRPALLRVQADR
FT                   GALGRFDQLAALRRHLGKRLRVQRHVVGVRVVLAASRERHHHGGHGAPLVSTHRSPLLP
FT                   SQGSRPRGASGGAYSFTRLPVKGMVTTHSASSQSATGGATRCSLRNHRWPWMVSSRCLF
FT                   VMTMLNAW"
     gtgctcgttg cggacccaga cagtgccctg gatggtgtca tccaggtcct tgttgtggat        60
     ggcgatgcgg aaggcgtgct cgttgcccag ggcggacagc ttgtgctcct catccaggcg       120
     cgtctggatg tggatgaact ggtagccgcc gtccgcgccc accgagccca tgagcacgtc       180
     cggctcgccg tcgccgttga tgacgtaggc gttgttcggc gtctggaagt cgatgtcggg       240
     gacctcgagg aacatcgagt ccatctcccc gcggcgaatc gtccagcgct gctgcgcgtc       300
     caggccgacc gcggggccct gggcaggttc gaccaactcg ctgcactccg tcggcacctg       360
     ggcaagcgtc tccgcgtcca gcgtcacgtc gtaggtgtac gtgtcgtcct cgccgcatcc       420
     cgtgagcgcc atcaccacgg cggccatggc gccccactgg tctccacgca tcggtctccg       480
     ctccttccgt cacagggctc gcgcccccgt ggcgcgagcg gcggagccta ctccttcacg       540
     cgcttgcccg tgaaagggat ggtcacgacg cattccgcct catcccaatc cgctaccgga       600
     ggcgcgacca ggtgctcact tcggaaccac agatggccgt ggatggtgtc gtccaggtgc       660
     ttgttcgtga tgacgatgct gaacgcctgg taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page