(data stored in ACNUC30630 zone)

EMBL: CP000113.PE633

CP000113.PE633       Location/Qualifiers
FT   CDS_pept        complement(750055..750471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0651"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABF88470"
FT                   /db_xref="InterPro:IPR021398"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DEK4"
FT                   /protein_id="ABF88470.1"
FT                   /translation="MPAPSSFDYAIIRVVPRVEREEFINAGVVLFCATQRFLGVRVEPD
FT                   EARLKALWPDVDVDMIRGHLESFRRVCEGGKGSGPIGQLSQKERWHWVVAPRSTIIQTG
FT                   PVHSGLCTEPQAALEHLLDTVVRMKRATPSPGGR"
     gtgcccgcgc ccagctcgtt tgattacgcc atcatccgcg tcgtcccgcg cgtggagcgc        60
     gaggagttca tcaacgcggg cgtcgtcctc ttctgcgcca cccagcgctt cctgggcgtg       120
     cgcgtggagc cggacgaagc gcggttgaag gcgctgtggc ccgacgtgga cgtggacatg       180
     attcgcggcc acctggagag cttccgtcgc gtgtgtgagg gcgggaaggg ctcggggccc       240
     attggccagc tatcccagaa ggagcgctgg cactgggtgg tggcgcctcg cagcaccatc       300
     atccagacgg ggccggtgca ctccggcctg tgtaccgagc cccaggcggc gctggagcac       360
     ctgctggaca cggtggtgcg gatgaagcgc gctactccgt cacccggcgg ccggtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page