(data stored in ACNUC30630 zone)

EMBL: CP000113.PE7

CP000113.PE7         Location/Qualifiers
FT   CDS_pept        complement(9261..10496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0009"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF05977;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABF86434"
FT                   /db_xref="GOA:Q1DGD0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGD0"
FT                   /protein_id="ABF86434.1"
FT                   /translation="MRTLRLPRLSSLRAFDHPGYFAVWVGALISTIGTWMETVAMGVYV
FT                   TEATGRAEWTGGIVALTFLPAVVLSPVGGALADRFDRRAYVALGTVVQLVLAGVLTLLA
FT                   FTHRLSVPVVAVISFVHGCASTLINPAFAAMLAELVPPRDLHSAMSLNSAQFNLGRIIG
FT                   PALAALVLSMGGTSWALLINTLSFVAVLVALSQVKTLTRKVTEGGQGLWKQIAHGFTVA
FT                   RGDPEISLMLWGTFLVAGLVAPFIGLVPVFAIRVFGQGAAATSLLVTCQGAGAVTAALL
FT                   VGTLVDRWGQRKLLGIVATSIGVVSTLYWLSPTLQMAAVVIFVLGANYMMLMSGMHAYC
FT                   QSRVPRELQARMSSLYSMVLGGAYASGVWGLGALADRLGIRFVTVSASVLFIALVLTLR
FT                   LLRPQRFDGAVA"
     gtgcgcaccc ttcgactgcc acgtctctcc tcgcttcgcg ccttcgacca ccccggctac        60
     ttcgcggtct gggtgggagc cctgatctcc accatcggca cctggatgga gacggtggcc       120
     atgggtgtgt acgtcaccga ggccacgggc cgcgccgagt ggacgggtgg catcgtcgcc       180
     ctcaccttcc tccccgcggt ggtgctgtcg ccggtgggcg gcgcgctcgc ggaccggttc       240
     gaccgtcgcg cctacgtcgc gctgggcacg gtggtgcagt tggtgctcgc gggcgtgttg       300
     acgctgctgg ccttcacgca ccggctcagc gtccccgtgg tggccgtcat ctccttcgtc       360
     cacggctgcg ccagcacgct catcaatccc gccttcgcgg cgatgctcgc ggagctcgtg       420
     ccaccccggg acttgcacag cgccatgagc ctcaactcgg cgcagttcaa cctggggcgc       480
     atcatcggtc cggcgctggc cgcgctggtg ctgagcatgg gcgggacgtc ctgggcgctg       540
     ctcatcaaca cactgtcctt cgtcgcggtg ttggtggcgc tgtcgcaggt gaagacgctg       600
     acgcgcaagg tgacggaggg cggtcagggc ctgtggaagc agattgccca tggcttcacc       660
     gtggcgcggg gggacccgga aatctcgctg atgctgtggg gcacgttcct cgtcgcgggc       720
     ctggtggcgc ccttcatcgg cctggtgccg gtgttcgcca tccgcgtctt cggccagggc       780
     gcggcagcca cgtccttgct cgtcacctgc cagggcgcgg gcgcggtgac ggcggcgctg       840
     ctggtgggca cgctggtgga ccggtggggc cagcggaagc tgctgggcat cgtggcgacg       900
     tccatcggcg tcgtgtccac gctctattgg ctgtcgccca cgctgcagat ggcggccgtt       960
     gtcatcttcg tgctcggcgc caactacatg atgctgatga gcgggatgca cgcgtactgc      1020
     cagtcgcgcg tgccccgtga gctgcaagcg cggatgagca gcctgtacag catggtactg      1080
     ggcggcgcgt acgcgtccgg cgtctggggc ctgggcgcgc tggcggaccg gctgggcatc      1140
     cgcttcgtca ccgtgagcgc cagtgtgttg ttcatcgcgt tggtgctgac gctgcgcctg      1200
     ttgcgtccgc agcgcttcga cggcgctgtc gcgtag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page