(data stored in ACNUC30630 zone)

EMBL: CP000113.PE83

CP000113.PE83        Location/Qualifiers
FT   CDS_pept        97598..98335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABF91490"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG54"
FT                   /protein_id="ABF91490.1"
FT                   /translation="MDSVLDNILFLVGQRMPRLQSSSAKPDAKLTLETAALWRQYGCGL
FT                   LLSELDDEGFRDGLEQAATLYLNLLNRRSACSEFDQYYLARSKGEPLLDALAAGNWDLA
FT                   RSIAAAMTPTWMQRMESEEDFHYFGALIALVLAQSHLGAELAAFERTLQGGGSHRFDVV
FT                   QALSKQEADAFDAGLHGMIEEQAAWVERQRRSGLFDPYRHKTEAFVFVEGAALVQLARR
FT                   LGVPTQERYRLIPSAALELQART"
     atggattcgg tcctcgacaa catccttttc ctcgtaggcc agcggatgcc ccggctccag        60
     tcgtcgtcgg cgaagccgga cgcgaagctg accttggaga ccgccgcgct ctggcgtcag       120
     tacggctgtg gcctcctgtt gtcggagttg gacgatgaag gcttccgaga cggcctggag       180
     caggcggcga cgctctacct gaacctgctc aaccgccgca gcgcgtgctc cgagttcgac       240
     cagtactacc tggcccgcag caagggcgag ccgctcctcg acgcgctggc tgcgggcaac       300
     tgggacttgg cccgctccat cgccgccgcg atgacgccga cctggatgca gcggatggag       360
     tcagaggagg acttccacta cttcggcgcc ctcatcgccc tggtgctcgc gcagtctcac       420
     ctgggcgcgg agctcgccgc gttcgagcgg acgctccagg gcggaggctc ccaccgcttc       480
     gacgtggtgc aggccctgtc aaagcaagag gccgatgcct tcgacgcggg cctccacgga       540
     atgattgagg agcaggccgc ctgggtcgag cgccagcggc gctccggcct gttcgatccc       600
     taccgccaca agacggaggc cttcgtcttc gtcgaaggcg ccgcgctggt ccaactggcc       660
     cgccgcctgg gcgtaccgac gcaggagcgc tatcgcctca tcccctctgc tgccttggaa       720
     ctccaggccc gcacttga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page