(data stored in ACNUC30630 zone)

EMBL: CP000113.PE9

CP000113.PE9         Location/Qualifiers
FT   CDS_pept        complement(12409..12978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0012"
FT                   /product="DoxD-like family protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92697"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DGC8"
FT                   /protein_id="ABF92697.1"
FT                   /translation="MPDPTYPGFRQRPRPIQGVAGMNVATLTEQPSILKAAALLPPRLS
FT                   LGSTMVVHGVSKLRAEGTAQHADLFEQLGFKPGKPWVIATGVVELLSGVSSILGIATRP
FT                   AALAILVTQAIAVAKVHGSKGFDITKGGFEFNLALGAIALGLLLRGPGPLSVHSAIERR
FT                   VKRKELRRLRFLPRQRRRSVLLDVLG"
     atgccggacc caacctaccc aggtttccgt caacggcccc ggcccatcca aggagtggca        60
     ggtatgaacg tggcgaccct gaccgagcaa ccgagcatcc tgaaggcagc ggccctgctg       120
     cccccgcgcc tgtcgctcgg gtcgacgatg gtggtgcatg gcgtgtccaa gctccgcgcc       180
     gagggcaccg cgcaacacgc ggacctcttc gagcaactgg gcttcaagcc aggcaagccc       240
     tgggtcatcg ccacgggggt ggtggagctg ctctcaggcg tgagctccat cctgggcatc       300
     gccacgcgcc ccgccgcgct ggctatcctc gtcacgcaag ccatcgccgt ggccaaggtc       360
     catggctcca agggcttcga catcacgaag ggcggcttcg agttcaacct ggcgctggga       420
     gccatcgcgc tcggcctgct gctgcgaggc ccgggaccgc tctccgtcca cagcgccatc       480
     gagcgccggg tgaagcgcaa ggagctgcgg cggctgcggt tcctgccgcg ccagcgccgt       540
     cgttcggtgc tgctcgacgt gctggggtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page