(data stored in ACNUC30630 zone)

EMBL: CP000113.PE91

CP000113.PE91        Location/Qualifiers
FT   CDS_pept        complement(107033..108109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MXAN_0094"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:MXAN_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABF92802"
FT                   /db_xref="GOA:Q1DG46"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1DG46"
FT                   /protein_id="ABF92802.1"
FT                   /translation="MIDGNFVIDAVTHAYNLHPTNYRAGKYAESLAGLIWGLHSGLSGD
FT                   THRVPTAEGFLKNWSVKELAHLLFVESGVDLAVHHVLPLQTLYHDGLCSYEKTLEIHRN
FT                   YPHRFLVYAGVDPLRGTAALDDLEQQYETLKPSGLKLYPAAWLGDKFRHTGWRMDDPTI
FT                   AFPLFERAQKLGIKNIAVHKGLPMGAVPLEPYKVDDIGGAADAFPDLNFEIVHGGMAFL
FT                   DETGMQLSLFPNVYVNLEVTGALIVKRERWFAESLAALLKWAGPEKIMWGSGTVFSHPH
FT                   PALHKFWHEFQLPDDLVQVAGMQVTPDVKRMILGGNYARYAGVDVESVKKKIANDTFAK
FT                   LRARGDIQPYGYRESLYE"
     gtgattgacg gcaacttcgt catcgatgcg gtgacacacg cctacaacct ccatcccacg        60
     aactaccgcg ccggcaagta cgccgagtcg ctcgcgggac tcatctgggg gctgcacagc       120
     ggactgtctg gggacacgca ccgcgtcccc acggcggaag gcttcctgaa gaactggtcc       180
     gtgaaggagc tggcgcacct gctcttcgtg gagagcggcg tcgacctggc ggtgcaccac       240
     gtgctgccgc tccagacgct gtaccacgac ggactgtgct cctatgagaa gacgctggag       300
     attcaccgca actatcccca ccgcttcctg gtgtacgcgg gcgtggaccc gctgcgcggc       360
     acggcggcgc tggatgattt ggagcagcag tacgaaacgc tcaagcccag cggcctgaag       420
     ctctacccgg cggcgtggct gggcgacaag ttccgccaca cgggctggcg catggatgac       480
     ccgaccatcg ccttcccgct cttcgagcgg gcgcagaagc tgggcatcaa gaacatcgcc       540
     gtgcacaagg gcctgcccat gggcgcggtg ccgctggagc cctacaaggt ggatgacatc       600
     ggcggggcgg cggatgcctt ccccgacctg aacttcgaaa tcgtccacgg cggcatggcc       660
     ttcctggacg agacgggcat gcagctgtcg ctgttcccca acgtgtatgt gaacctggaa       720
     gtgacgggcg cgctcatcgt gaagcgtgaa cgctggttcg ccgagtccct ggcggcgctg       780
     ctgaagtggg ccggcccgga gaaaatcatg tggggctccg ggacggtgtt cagccacccg       840
     cacccggcgc tgcacaagtt ctggcatgag ttccagctgc cggacgacct agtgcaggtg       900
     gcgggcatgc aggtgacgcc ggatgtgaag cggatgattc tgggcggcaa ctacgcgcgc       960
     tacgcgggcg tggacgtgga gtcggtgaag aagaagattg ccaacgacac gttcgccaag      1020
     ctgagggcac gcggcgacat ccagccgtac ggctaccggg agagcctgta tgagtga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page